Details for Chinese cabbage Locus Brara.G03401

Position : A07 ( 5`- 25745400 .. 25746868 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03401

Protein [Map View]
MATVANFSANRITTVIPRPTSAVSSSSSFVFFDPKPNSLILKQSCVKNPSKRRFSAVKVKAGAAPPGKVGTPAIKDEKVQ
KIHSGEEFDEALKKAKNKLVVVEFATSKSDQSSKIYPFMVELSRTCNDVDFLLVMGDESEKTRELCRREKIEKVPHFSFY
KSMEKIHEEEGIGPDQLMGDVLYYGDSHSAVVQLHGRADVEKLIDENRTGGKLIVLDVGLKHCGPCVKVYPTVLKLSRSM
SETVVFARMNGDENDSCMEFLKDMNVIEVPTFLFIRNGDICGRYVGSGKGELIGEILRYSGVRVTY*

DNA
ATGGCCACCGTCGCTAACTTCTCAGCCAACCGAATCACCACCGTGATTCCACGGCCAACATCCGCCGTTTCTTCCTCCTC
CTCGTTCGTATTCTTCGACCCCAAACCCAACTCACTGATCCTAAAACAGAGCTGTGTTAAAAATCCCTCGAAAAGAAGAT
TCTCAGCCGTGAAGGTCAAGGCCGGTGCGGCGCCACCGGGGAAGGTGGGTACACCGGCAATAAAGGACGAGAAAGTGCAA
AAGATTCACAGCGGAGAGGAGTTCGACGAAGCGCTTAAGAAGGCCAAGAACAAGCTTGTGGTTGTGGAGTTTGCCACGAG
TAAGAGTGATCAGAGCAGCAAGATATATCCGTTTATGGTGGAGCTGAGCAGGACATGTAACGACGTCGACTTCTTGCTCG
TCATGGGTGATGAGTCCGAAAAGACAAGAGAGCTTTGTCGGAGAGAGAAGATCGAGAAAGTTCCTCACTTCAGCTTTTAT
AAGAGCATGGAGAAAATACACGAGGAAGAAGGTATTGGCCCCGACCAGCTAATGGGGGACGTGTTATACTACGGGGACAG
CCACTCGGCGGTGGTGCAGCTACACGGCCGAGCTGATGTGGAGAAGCTTATTGATGAGAACCGTACTGGAGGCAAGCTGA
TTGTACTCGACGTTGGTCTGAAACACTGTGGGCCATGTGTCAAGGTTTATCCGACGGTGCTGAAGCTGTCCCGGTCGATG
TCGGAGACTGTCGTGTTCGCTAGAATGAACGGGGACGAGAACGATAGCTGTATGGAGTTTCTAAAAGACATGAATGTTAT
CGAAGTGCCCACGTTCTTGTTCATTAGAAACGGTGATATTTGTGGGCGGTATGTTGGTTCCGGTAAAGGAGAACTTATTG
GAGAGATTCTCCGGTACTCAGGCGTCCGTGTCACTTATTAA