Details for Chinese cabbage Locus Brara.G03398

Position : A07 ( 5`- 25721505 .. 25724030 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03398

Protein [Map View]
MLSISPVSSFSITSVKYLRSPSSSSFISVFPKLSRFVTATSATPNSTPETTTTRVNNAGLKLDETVSVSKGKIRLDSWIS
SRVDGVSRARVQSSIRQGLVSVNGHVIDKVSHNVKAGDEVHCTISKLQPLRAEPEDIPLDIVYEDQHVLVVNKPPHMVVH
PAPGNPNGTLVNGILHHCSLPCVATYSNQEDDDDSDEEETFSDDEGMIRPGIVHRLDKGTSGLLVVAKDEHSHAHLAEQF
KLHTIERVYISLTTGVPSPSQGRIDVPIGRDSNNRIRMAAIPGSLSRGRARHAASRYKVVETLAGGGSALVEWRLETGRT
HQIRAHAKYMGVPLLGDEVYGGTKSMALSLLQRRVSRSDQEEIIELVSRMDRPCLHAIVLGFEHPCTGEIIKFSCPPPPD
LAEIVGLLRRSGRDKVE*

DNA
ATGCTCTCCATCTCTCCGGTGTCGAGCTTCTCTATAACCTCCGTGAAATATCTTCGCTCTCCTTCCTCTTCCTCCTTCAT
CTCCGTCTTCCCTAAACTTTCCAGATTCGTCACAGCCACTTCCGCAACCCCCAATTCAACACCGGAGACCACCACCACGA
GAGTCAACAACGCCGGCCTCAAACTCGACGAGACAGTCTCCGTCTCCAAAGGCAAGATTCGCCTCGACTCATGGATCTCC
TCTCGCGTCGATGGAGTTAGCCGAGCTCGCGTACAGTCCAGCATCCGCCAAGGACTCGTCTCCGTCAATGGCCACGTCAT
CGATAAGGTTTCGCACAATGTGAAAGCTGGCGATGAGGTTCATTGTACGATATCAAAGCTCCAACCTTTGAGAGCTGAAC
CCGAAGACATACCGTTAGATATAGTTTACGAAGATCAGCACGTGCTCGTCGTTAACAAACCGCCTCACATGGTTGTTCAT
CCTGCGCCTGGGAATCCTAATGGGACGCTTGTTAACGGAATACTTCACCATTGTAGTCTCCCTTGTGTTGCTACTTATTC
AAACCAAGAAGATGATGATGATTCGGATGAAGAAGAAACGTTTTCAGATGATGAAGGGATGATTCGTCCAGGTATTGTTC
ATAGGTTGGATAAAGGGACTAGTGGATTGCTCGTTGTAGCTAAGGATGAGCATTCTCATGCTCATTTGGCGGAACAGTTC
AAGCTGCACACGATTGAGAGAGTTTATATAAGTCTTACCACTGGAGTTCCTTCTCCGTCTCAGGGGAGGATTGATGTACC
GATTGGTAGGGATTCGAATAATCGGATCCGTATGGCTGCTATACCTGGATCATTGAGCCGTGGAAGGGCTCGTCATGCTG
CTAGTAGGTATAAGGTAGTTGAAACACTCGCTGGAGGTGGCTCTGCGTTGGTTGAGTGGAGACTAGAAACTGGCCGTACA
CATCAGATACGTGCGCATGCCAAGTACATGGGAGTACCTCTACTGGGTGACGAAGTGTATGGAGGAACGAAAAGCATGGC
ACTTTCTCTTCTGCAGAGAAGAGTCTCCCGGAGTGATCAAGAAGAGATCATAGAGCTGGTGTCAAGAATGGATAGGCCTT
GTCTTCATGCTATAGTTCTCGGCTTTGAACATCCGTGCACAGGAGAAATCATAAAGTTTTCATGTCCACCGCCTCCGGAT
CTTGCTGAGATAGTAGGCCTGCTTCGTAGAAGCGGAAGAGACAAAGTGGAATAA