Details for Chinese cabbage Locus Brara.G03396

Position : A07 ( 5`- 25714579 .. 25717500 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03396

Protein [Map View]
MGANDIDMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNK
FTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQK
IPLFSAAGLPHNEIAAQICRQAGLVKRLEKTADLLEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLA
NDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGR
KGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYA
NYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQFY
SRDSTTTT*

DNA
ATGGGAGCGAATGATATCGACATGGAAGAAGGAACTCTAGAGATCGGCATGGAGTATAGAACTGTTTCTGGCGTTGCTGG
ACCATTAGTCATTCTTGACAAAGTCAAGGGTCCAAAGTACCAGGAGATTGTTAATATCCGTTTAGGTGATGGATCAACGA
GACGTGGTCAAGTTCTGGAAGTCGACGGGGAGAAAGCTGTTGTGCAGGTTTTTGAAGGAACATCTGGAATTGATAACAAG
TTTACAACCGTACAATTCACAGGAGAGGTTTTGAAAACACCTGTGTCCTTGGACATGCTTGGGCGCATATTTAACGGTTC
TGGAAAGCCGATTGATAATGGCCCTCCTATTTTGCCAGAGGCCTACCTTGATATTTCAGGAAGTTCAATCAACCCCAGTG
AAAGAACCTATCCCGAGGAGATGATACAAACAGGTATCTCGACTATTGATGTCATGAACTCCATTGCTCGTGGACAGAAG
ATTCCTCTTTTCTCTGCTGCTGGTCTCCCTCATAATGAAATCGCTGCTCAGATTTGTCGTCAAGCTGGTCTTGTCAAGCG
TCTGGAAAAGACTGCTGATCTACTTGAGGATCATGGAGAGGACAATTTTGCGATTGTGTTTGCAGCTATGGGTGTGAACA
TGGAGACGGCTCAGTTTTTCAAGCGAGATTTTGAAGAAAATGGATCAATGGAGAGAGTTACTCTTTTCTTGAATCTGGCC
AATGATCCGACCATTGAGAGAATCATCACTCCACGAATTGCCCTAACAACAGCAGAATACCTAGCTTATGAATGCGGGAA
ACACGTCCTTGTTATATTGACTGACATGAGTTCCTATGCTGATGCTCTTCGTGAGGTTTCTGCTGCAAGAGAAGAAGTTC
CAGGAAGACGTGGATATCCAGGTTATATGTACACTGATCTTGCTACTATCTATGAACGTGCTGGGCGTATCGAAGGAAGA
AAAGGTTCCATCACCCAGATACCAATCCTTACTATGCCCAATGATGACATCACACATCCAACCCCGGATCTTACTGGTTA
CATCACTGAAGGTCAGATATATATCGATAGGCAGCTTCACAACAGACAGATATATCCACCAATCAATGTGCTTCCATCTC
TTTCTCGTCTAATGAAGAGTGCTATTGGTGAGGGCATGACTCGTAAAGACCATTCAGATGTGTCGAACCAGCTATACGCA
AACTATGCTATCGGGAAAGATGTGCAAGCCATGAAAGCTGTGGTTGGAGAAGAAGCACTTTCGTCAGAGGATCTGCTTTA
CTTAGAGTTTTTGGATAAGTTCGAGAGGAAGTTTGTGATGCAAGGAGCTTATGACACACGGAACATCTTCCAGTCGCTGG
ACTTGGCTTGGACATTGCTCCGTATCTTCCCACGCGAGCTACTTCACCGTATCCCTGCAAAGACACTTGACCAATTCTAC
AGCCGCGACTCAACAACAACGACCTAA