Details for Chinese cabbage Locus Brara.G03394

Position : A07 ( 5`- 25709087 .. 25711622 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03394

Protein [Map View]
MTTTTQDVEMKDNNQTPPQSIVSATTSTLQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIRQKLTASVVASFLDFALGP
GSEAHARLSSFVPKSDEHDMEVDTASSTSLAASKHVPVELEIYCYFIVLLFLIDQKKYNEAKACSSASIARLKSLNKRTI
DVIASRLYFYYSLSYEMTGDLAEIRGTLLSLHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQ
QFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAILVRLLLGEIPERSIFMQKGMEKALRPYFELT
NAVRIGDLELFRNVQEKFSKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSANPVADAESIVAKA
IRDGAIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNMHNEAVRALRFPPNTHREKESEEKRREMKQQEEELA
KYMAEEDDDDF*

DNA
ATGACGACGACGACTCAAGACGTGGAGATGAAAGACAACAACCAAACCCCACCTCAATCCATCGTCTCCGCCACCACCTC
AACTCTCCAGCATCTGAAGGAGATCGCTGCTCTGATCGATACCGGCTCCTACACCAAAGAAGTCCGCCGCGTCGCTCGCG
CCGTTCGCCTCACCGTCGGGATACGGCAGAAGCTCACCGCTTCCGTCGTCGCTTCGTTCCTTGACTTCGCTTTGGGTCCT
GGATCTGAGGCTCACGCTCGTCTCTCTTCGTTCGTTCCCAAGAGTGATGAACATGACATGGAGGTTGATACTGCTTCCTC
CACTTCCTTGGCTGCATCCAAGCACGTGCCTGTGGAGCTTGAGATCTACTGCTACTTCATTGTTTTGCTTTTTCTGATTG
ATCAGAAGAAGTACAACGAGGCCAAAGCTTGCTCATCAGCTAGCATTGCTCGTCTCAAGAGCTTGAACAAGAGAACCATT
GATGTGATAGCTTCGAGATTGTATTTTTACTACTCTTTGAGTTATGAGATGACTGGTGATCTTGCTGAGATTCGTGGTAC
TCTTCTGTCCTTGCACCACTCTGCAACTCTGCGCCATGATGAGTTGGGTCAGGAAACACTTCTGAATCTCTTACTTCGTA
ACTACCTGCACTACAACCTTTATGATCAAGCTGAGAAGCTGAGATCTAAAGCACCAAGATTTGAGGCACATTCAAATCAG
CAGTTCTGTAGGTACTTGTTTTACCTCGGTAAGATCCGTACGATCCAACTCGAGTACACTGATGCAAAAGAGAGCCTCCT
CCAGGCGGCTAGAAAAGCACCTGTCGCTGCTCTAGGCTTCAGAGTCCAGTGCAACAAGTGGGCTATTTTAGTTCGTCTCC
TCTTGGGTGAGATTCCAGAGCGATCCATCTTCATGCAGAAAGGAATGGAGAAGGCTCTTAGGCCATACTTCGAACTTACC
AATGCTGTGAGAATTGGTGACTTGGAGCTCTTCAGGAACGTCCAAGAGAAGTTTTCAAAGACATTCTCCGAGGACAGGAC
TCACAACCTCATTGTCAGACTCCGTCACAACGTGATCAGGACAGGACTGCGCAACATCAGCATCTCCTACTCGAGAATCT
CTCTCACAGACGTCGCCCAGAAGCTAAGGCTGAACTCCGCAAACCCTGTCGCAGATGCAGAGAGCATAGTGGCTAAGGCC
ATAAGAGACGGAGCAATCGACGCGACCATCGACCACAAGAATGGTTACATGGTCTCGAAGGAGACAGGAGACATCTACTC
CACCAACGAGCCGCAGAACGCGTTTAACTCGAGGATTGCCTTCTGTTTGAACATGCACAACGAAGCGGTGAGGGCGCTGA
GGTTCCCGCCGAACACACACAGGGAGAAAGAGAGCGAGGAGAAGAGGAGGGAGATGAAACAGCAAGAAGAGGAGCTCGCT
AAATACATGGCTGAGGAAGATGACGACGATTTCTAG