Details for Chinese cabbage Locus Brara.G03393

Position : A07 ( 5`- 25706980 .. 25708434 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03393

Protein [Map View]
MEEIQNIDVTKNPEPEVIIESTKQKQSEEVEHHCDEQQKQSQEEEDELRKLLLSDIGELPLSPPSATQLNFVSYFITDFT
KPGHDHYIYRHANGLCVIGLAPTHIAFKDQGGITNIDFNVGKSDRSVLKVSGKRKKNAMRSESNTALCKVSTANDSYIVR
CCVKGSLLEVNERLIKQPQLLNSSADREGYIAIIMPRPADWTKNKESLITSEEYKDKKQDGLLEPCLL*

DNA
ATGGAGGAGATTCAGAACATTGACGTTACAAAGAATCCAGAACCCGAAGTTATAATCGAATCAACTAAGCAAAAGCAATC
CGAAGAAGTAGAACATCACTGCGACGAGCAGCAGAAGCAATCACAAGAAGAAGAAGACGAATTGCGAAAGCTTCTGCTTT
CAGATATAGGAGAGCTTCCTCTTTCTCCTCCTTCAGCTACACAACTCAACTTCGTCTCTTACTTTATCACAGATTTTACT
AAACCGGGTCATGATCACTACATCTACCGTCACGCCAACGGTTTGTGTGTGATTGGATTGGCTCCTACTCATATAGCTTT
TAAGGACCAAGGTGGGATCACTAACATTGATTTCAATGTCGGTAAGTCTGATCGTAGCGTCTTGAAAGTCTCTGGCAAAC
GTAAAAAGAATGCTATGCGGTCTGAATCGAATACAGCATTGTGCAAAGTCTCCACTGCTAATGATTCTTATATTGTCAGG
TGTTGCGTTAAAGGTTCGCTCTTGGAGGTGAACGAGAGATTGATCAAGCAACCTCAGCTTCTTAATTCATCGGCTGATCG
AGAAGGATATATTGCGATAATCATGCCAAGACCTGCAGATTGGACCAAAAACAAGGAATCACTGATAACCTCGGAGGAGT
ATAAAGACAAGAAACAAGACGGTTTACTAGAACCGTGTCTACTTTGA