Details for Chinese cabbage Locus Brara.G03382

Position : A07 ( 5`- 25646659 .. 25647213 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03382

Protein [Map View]
MIKFVSIITLLFAALVLFAAFESPTMVDAQKLCQKPSATWYGLCGNSNNCKNQCINLEGARHGSCNYIFPYHRCICYIPC
*

DNA
ATGATTAAGTTTGTTTCCATCATCACCCTTCTCTTTGCTGCTCTCGTTCTCTTTGCTGCTTTTGAATCACCAACAATGGT
GGACGCGCAGAAGTTGTGCCAGAAGCCTAGTGCGACGTGGTACGGATTATGTGGAAATAGTAATAATTGCAAGAACCAGT
GCATCAACCTTGAGGGAGCACGACATGGATCTTGTAACTATATTTTTCCATATCACAGGTGTATCTGCTATATCCCATGT
TAA