Details for Chinese cabbage Locus Brara.G03374

Position : A07 ( 5`- 25598477 .. 25599276 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03374

Protein [Map View]
MAISKALIASLLISLLVLQLVQADVENSNKKRGYRKKIDCGSACVARCRLSSRPNLCHRACGTCCARCNCVPPGTYGNYD
KCQCYATLTTHGGRRKCP*

DNA
ATGGCGATTTCAAAAGCCCTTATTGCTTCTCTTCTCATATCTCTTCTTGTTCTCCAACTCGTCCAGGCCGATGTGGAAAA
CTCAAACAAAAAGAGGGGTTACCGCAAAAAAATTGATTGTGGAAGTGCTTGTGTAGCAAGGTGCAGGCTCTCAAGTAGAC
CTAACCTTTGCCACAGAGCGTGCGGGACTTGTTGCGCAAGATGCAACTGTGTGCCACCTGGTACGTACGGAAACTACGAC
AAGTGCCAGTGCTATGCTACCCTCACCACCCACGGTGGTCGCCGCAAGTGCCCTTAA