Details for Chinese cabbage Locus Brara.G03371

Position : A07 ( 5`- 25591046 .. 25591315 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03371

Protein [Map View]
MKLFHKFRKILMRLIDITLPCSSRRQRKSGEGERFEPPKISCSSSYYSSHVHYNEAIADCIEFFNKSSAMSCDADHGGRH
VEDRDCFYV*

DNA
ATGAAGCTCTTCCACAAGTTTCGAAAGATTCTCATGAGGCTCATCGACATCACTCTTCCTTGCTCCTCCCGCCGACAAAG
GAAATCAGGCGAGGGAGAGAGGTTTGAGCCGCCGAAGATATCTTGCAGTAGTTCGTACTATTCTTCTCACGTACACTACA
ATGAAGCTATCGCAGATTGCATAGAGTTCTTTAATAAGTCTTCCGCTATGTCTTGTGATGCGGATCATGGAGGTCGTCAT
GTAGAGGATCGTGACTGTTTTTACGTTTAA