Details for Chinese cabbage Locus Brara.G03370

Position : A07 ( 5`- 25586218 .. 25588695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03370

Protein [Map View]
MALLTILPENAEPPKHTPPPSKRKKRENPTEQPHKPQKPHKPQKQKAAAPQKQPSSWDQIKNLLTCKQIEGSRVHDPSKN
SQPAPSTTANLSPSKLSSSCSSICSFRDVAHGNTRVVHRADNSPDVDKSATPDSETRLLTRKPGQHGSSSRSLTSGSTRS
NASGSYTSSSTTSFRAMQFRKLSGCYECHMIVDPSRYPISPRVCACSQCGEVFPKLESLELHQAVRHAVSELGPEDSGRN
IVEIIFKSSWLKKDSPMCKIERILKVHNTQRTIQRFEDCRDAVKARALQTARKDARCAADGNELLRFHCTTLTCSLGSRG
SSSLCSNLPSCGVCNVIRHGFQGKSGAGGVAAAAASSGGVRTTASSGRADDLLRCSDDARRVMLVCRVIAGRVKRVDLPA
DSTVEEKKSPVEDNSTVGASTSGGVFDSVAVNAGVYSNLEELVVYNPRAILPCFVVIYKVLES*

DNA
ATGGCTTTACTAACCATCTTGCCGGAAAACGCAGAACCTCCAAAACATACTCCACCGCCTAGCAAACGCAAGAAACGCGA
GAATCCCACCGAGCAACCGCATAAACCGCAGAAACCACACAAACCACAAAAGCAGAAAGCAGCAGCACCTCAGAAGCAAC
CGTCTTCATGGGACCAAATCAAGAACCTCTTGACTTGCAAACAAATCGAAGGGTCAAGAGTTCACGACCCCTCCAAGAAC
TCTCAGCCTGCTCCGTCCACGACGGCTAACTTATCACCTTCCAAGCTCAGCTCGTCGTGCAGCTCTATATGCAGCTTCCG
AGACGTGGCTCACGGCAACACTCGCGTGGTTCACAGAGCAGACAACTCTCCGGACGTAGATAAATCGGCTACTCCTGACT
CGGAGACTCGTCTTCTGACTCGGAAACCTGGTCAACACGGCTCTTCATCTCGGTCTCTAACGTCTGGCTCAACTAGATCT
AACGCCAGCGGAAGCTACACGTCGTCCTCAACGACGTCGTTCAGAGCCATGCAGTTCCGTAAACTCTCTGGTTGTTACGA
ATGTCACATGATTGTTGACCCTAGCAGGTATCCGATTTCACCTAGGGTTTGTGCTTGTTCCCAATGTGGAGAAGTTTTTC
CAAAGCTTGAAAGCTTAGAGCTTCATCAAGCGGTTCGTCACGCAGTTTCTGAGTTAGGTCCGGAAGATTCGGGTCGAAAC
ATAGTGGAGATCATATTCAAGTCAAGCTGGCTTAAAAAGGACAGTCCAATGTGTAAGATCGAACGGATACTAAAAGTACA
CAACACTCAACGCACGATCCAACGGTTCGAAGATTGCCGAGACGCAGTGAAGGCGCGTGCGCTTCAGACCGCAAGAAAAG
ACGCTCGTTGTGCTGCTGACGGCAACGAGCTTCTCCGCTTCCACTGCACCACTCTGACTTGCTCTCTCGGATCTCGTGGC
TCGTCCTCTCTCTGCTCTAATCTCCCCAGCTGCGGCGTATGCAACGTGATTCGCCACGGTTTCCAAGGGAAGTCCGGCGC
CGGAGGAGTCGCCGCCGCCGCAGCATCTAGCGGCGGTGTGAGGACAACGGCGAGCAGCGGAAGAGCTGATGATTTGCTGA
GGTGTAGCGATGATGCTAGGAGAGTGATGCTTGTGTGTCGTGTGATCGCTGGGAGAGTTAAGCGCGTCGATTTACCGGCG
GATTCTACGGTGGAGGAGAAGAAGTCTCCAGTGGAAGATAACTCGACGGTTGGAGCTTCTACGAGCGGCGGTGTGTTTGA
CTCTGTGGCGGTCAACGCTGGAGTTTATTCTAACCTGGAGGAGCTGGTGGTTTATAACCCAAGAGCTATATTACCTTGCT
TCGTGGTTATTTACAAAGTTTTAGAATCTTGA