Details for Chinese cabbage Locus Brara.G03366

Position : A07 ( 5`- 25568756 .. 25574275 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03366

Protein [Map View]
MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIHPCFHPEDRPSPTTFEEVFQC
MFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQQRSRRFRSAKDASDAAAEEEKLREEFEREGRRLPPKIDSQVFDSNVI
TPGTEFMGVLSIALQYYVHMRLNYDAGWKNIKVILSDANVPGEGEHKIMSYIRLQRNLPGFDPNTRHCLYGLDADLIMLG
LATHEVHFSILREVVFTPGQQDKCFLCGQMGHMASDCEGKAKKRAGEFDEKGDGFVKKPYQFLHIWILREYLEFYPYHYA
PFASDLKDLGELDIKFELGTPFKPFNQLLGVFPAASAHALPERYRTLMTDPNSPIIDFYPTDFEVDMNGKRYSWQGIAKL
PFIDEKRLLEAVSEVEFTLTDEEKRRNSMMCDMLFIATSHRLAELIFSLDNHCRQLSEKERLYYKAKIRPELSDGMNGYL
TPCSGETHPPVFRSPVEGKEDILDNQVICCIYRLPDAHEHITRPPPGVIFPKKIVNIGDLKPPPALWHEDNGRRPMHNHN
NNYYNNNNNNSNHQGRHVGDAAHRLVTNSLDRRTDRDRYQRGDVHSQHHNHPGYGYNQPPPPYVPPVPYQHGGGYMAPPP
GVQGYAQQQGPYQSRGGYQPRGTSGRFPSDPYPVQPRGGGHRDNRGGGYSGGYNQHHHQQYEQHGHGEGGSEHYNPREYG
GQQHHRQHQQGGDRRGSHHRGRY*

DNA
ATGGGAGTACCAGCGTTTTACCGGTGGCTAGCGGAGAAGTATCCGCTGATAGTGTCTGACGTCGTCGAGGAAGAAGCTGT
CGAAATCGAGGGAATCAAGATCCCGGTGGATACTAGTAAACCTAACCCTAACAATCTCGAATACGATAATCTCTACCTTG
ACATGAACGGCATCATCCATCCTTGCTTCCACCCTGAAGACAGGCCCTCGCCGACAACCTTTGAGGAGGTGTTTCAGTGT
ATGTTTGACTATATCGATAGGCTTTTTGTGATGGTACGGCCGAGGAAGCTGCTCTATATGGCTATTGATGGTGTTGCTCC
AAGAGCTAAAATGAATCAACAACGATCTAGACGGTTTAGATCTGCTAAAGATGCTTCCGATGCTGCTGCTGAAGAAGAAA
AGCTGAGAGAGGAATTTGAGAGGGAGGGTAGAAGACTCCCTCCTAAAATTGACTCTCAAGTGTTTGATTCCAACGTTATC
ACACCTGGGACAGAGTTCATGGGTGTTCTGTCTATCGCCCTGCAGTATTATGTGCACATGAGACTTAACTATGATGCTGG
TTGGAAAAATATCAAGGTTATCCTCTCAGACGCAAATGTTCCAGGTGAAGGGGAGCATAAGATCATGTCATACATTCGTC
TTCAAAGGAACCTCCCTGGTTTTGACCCAAACACTCGCCATTGCTTGTATGGATTGGACGCTGACCTGATTATGTTGGGC
TTGGCTACCCATGAAGTTCATTTCTCAATTCTTAGAGAGGTGGTCTTCACTCCTGGCCAGCAGGACAAATGCTTCTTGTG
TGGTCAAATGGGCCATATGGCTTCAGACTGTGAAGGAAAAGCAAAGAAGAGGGCAGGAGAGTTCGATGAGAAGGGCGATG
GTTTTGTTAAAAAGCCATATCAGTTTCTTCATATATGGATTCTTAGAGAGTACCTGGAGTTTTATCCTTACCATTACGCA
CCATTTGCTTCTGATCTGAAGGATCTAGGAGAGCTGGATATTAAGTTTGAGTTAGGAACTCCGTTTAAGCCTTTCAATCA
ACTTCTTGGGGTGTTCCCAGCTGCAAGTGCACATGCTCTCCCAGAGCGCTATAGGACCTTGATGACCGATCCCAACTCAC
CCATCATTGATTTTTACCCAACTGATTTTGAAGTTGATATGAATGGAAAGCGCTATTCCTGGCAGGGTATTGCTAAGCTA
CCTTTCATTGATGAAAAACGCCTTCTTGAAGCTGTTTCCGAAGTTGAATTCACGTTGACGGATGAAGAGAAGCGTAGAAA
CAGCATGATGTGTGACATGCTATTCATTGCAACGTCTCATCGCCTTGCTGAACTCATCTTTTCCCTTGACAACCATTGTC
GTCAACTGAGTGAAAAGGAGAGACTATACTATAAGGCTAAGATCAGACCTGAGCTCAGTGATGGTATGAACGGCTACTTG
ACTCCCTGTTCAGGGGAGACTCACCCTCCTGTGTTTAGGTCCCCAGTGGAGGGTAAGGAGGACATCTTGGACAACCAAGT
CATTTGCTGCATTTACAGACTTCCGGATGCACATGAACACATAACCAGACCTCCTCCAGGTGTCATCTTCCCCAAGAAGA
TTGTGAACATAGGTGACTTGAAACCCCCACCTGCTCTGTGGCATGAGGACAATGGAAGGAGACCGATGCATAATCACAAT
AATAATTATTATAACAACAATAATAATAATAGTAATCATCAAGGGAGGCATGTGGGAGACGCAGCACATCGTCTTGTCAC
CAACAGCTTAGATAGGAGAACAGACCGGGACAGGTATCAGAGAGGAGATGTACATTCTCAGCATCATAATCATCCTGGTT
ACGGCTACAATCAGCCACCGCCGCCGTATGTTCCACCGGTTCCTTACCAGCATGGCGGTGGCTATATGGCTCCTCCACCT
GGCGTGCAAGGCTATGCTCAGCAACAAGGTCCTTATCAGAGTAGAGGTGGGTACCAGCCTCGTGGAACCAGTGGGAGGTT
CCCGTCGGATCCTTACCCGGTTCAGCCAAGAGGAGGAGGCCACCGTGACAACAGAGGAGGAGGTTATTCTGGTGGGTACA
ACCAACACCATCATCAACAATATGAGCAGCATGGGCACGGTGAAGGTGGGTCTGAGCATTATAACCCACGAGAGTATGGT
GGTCAGCAGCATCACCGTCAGCATCAGCAAGGTGGTGATCGCAGAGGAAGTCATCATCGTGGTCGTTATTAA