Details for Chinese cabbage Locus Brara.G03365

Position : A07 ( 5`- 25564134 .. 25567550 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03365

Protein [Map View]
MAATVIFFLHFTFFAAVFLHTSAVSPETQALTSLKLSLRDPLGALETWNESSPSAPCDWHGVLCFSGRVRELLLPRLRLA
GRLSPRLGELTQLRKLNLHTNDINGPVPSSLSRCVFLKAVYLHYNSFSGEFPPEILSLRNLQVLNAAHNSLTGSIANVTL
SKSLRHVDLSSNALSGPIPASFSPESSLKLINLSYNRFSGEIPASLGHLQSLEYLSLESNHLQGTIPSALSNCSSLKHFT
AAVNSLTGLVPTTLGNIPTLQVISLSQNSLTGTVPASLLCGYSRYNSSSMRIIQLGVNNFTGLATPSNAACVNPNLEILD
LHENNIGHEFPTWLLTGLTSLIVLDISGNGLTGEFPAKIGSFTALQELRAANNSFVGEIPTTIGECRSLRVIDFEGNKLS
GQVPGFLSRLQSLTALSLGRNGFSGRIPSDLLRLNGLEALSLNENRLTGDIPSEITKLANLSVLNLSFNRFSGEIPSNVG
DLKSLSVLNLSGCGLTGRIPVSIAGLMKLRVLDLSKQRISGELPVELFGLPDLQVVALGHNGLNGLVPEGFSSLVSLRFL
NLSSNLFSGRIPSNYGFLKSLEVLSLSRNRISGSVPAEIGNCSSLEVLELGSNRLEGHIPVRLSKLSHLKKLDLSHNKLT
GDIPVQMSKDSSLETLLLNSNSLSGPIPESLSRLRNLTGLDLSSNRFNSTIPSTLSRLHSLKYLNLSRNRLEGEIPQALA
ARFNNTSVFSNNPRLCGKPLGLECENVRRRRRRKLILLVTLAAAGALLLLLCCCGYVFSLWRWRKKIRLGLGWDKKGTPS
RTSGTSSGGTRGEDNNGGPKLVMFNNKITLAETLEATRQFDEENVLSRGRYGLVFKATFKDGMVLSVRRLMDGASITDAT
FRNQAEALGRVKHKNITVLRGYYCGPPDLRLLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLSFLHSLS
IVHGDLKPQNVLFDADFEAHLSEFGLDRLTALTPAEEPSTSSTPVGSLGYIAPEAGLTGQTSKESDVYSFGIVLLEILTG
KKAVMFTEDEDIVKWVKRQLQKGQIVELLEPGLLELDPESSEWEEFLLGIKVGLLCTGGDVVDRPSMVDVVFMLEGCRVG
PAISLSADPTSPAAEAAS*

DNA
ATGGCCGCAACGGTCATTTTCTTCCTCCACTTCACATTCTTCGCCGCCGTCTTCCTCCACACCTCCGCCGTTTCACCTGA
GACGCAAGCTCTCACCTCCCTCAAACTCTCTCTCCGCGACCCTCTAGGCGCTCTCGAAACCTGGAACGAGTCCTCTCCCT
CCGCCCCATGCGACTGGCACGGCGTCCTCTGCTTCTCCGGCCGCGTCCGCGAGCTTCTCCTCCCCCGCCTCCGCCTCGCC
GGCCGCCTCAGCCCTCGACTCGGCGAGTTGACTCAGCTCCGCAAGCTCAACCTCCACACCAACGACATAAACGGCCCCGT
TCCGTCTTCTCTCTCTCGCTGCGTCTTCCTCAAGGCGGTTTACCTTCACTACAACTCGTTCTCCGGCGAGTTTCCGCCGG
AGATATTGTCTCTCAGGAACCTACAAGTCCTCAACGCTGCTCACAACTCCCTCACCGGGAGCATAGCCAACGTCACTCTC
TCCAAGAGCCTCCGTCACGTCGACTTGTCTTCAAACGCCTTATCCGGTCCCATTCCGGCGAGTTTCTCGCCGGAATCTTC
CCTCAAGCTCATCAACCTCTCCTACAACCGGTTCTCCGGTGAGATCCCGGCTTCTCTCGGCCACCTACAGAGCCTAGAGT
ACCTATCGCTAGAGTCTAACCACTTACAAGGAACGATACCGTCAGCGTTATCTAACTGTTCCTCGCTGAAACACTTCACC
GCCGCCGTTAACTCCCTCACCGGCCTAGTGCCAACGACTCTCGGGAATATTCCGACTCTCCAAGTGATCTCACTCTCCCA
AAACTCCCTCACCGGTACGGTTCCAGCGAGTCTCCTATGCGGTTATTCTCGTTACAACTCCTCTTCCATGCGAATCATTC
AGTTAGGCGTTAATAACTTCACGGGGTTAGCTACGCCGTCAAATGCAGCCTGCGTGAATCCTAATCTCGAGATTCTCGAC
CTTCACGAGAACAACATTGGTCACGAGTTTCCCACGTGGTTGTTGACCGGTTTGACCTCATTAATTGTTTTGGATATATC
CGGAAACGGTTTAACCGGCGAGTTTCCGGCGAAAATCGGGAGCTTCACGGCGCTTCAGGAGCTCAGAGCAGCGAACAACT
CCTTCGTCGGAGAGATTCCGACGACAATCGGAGAATGCAGGTCGTTGCGGGTCATTGACTTCGAAGGAAACAAGCTCTCG
GGTCAAGTCCCGGGTTTTTTGAGTCGGTTACAGTCTCTAACGGCGTTATCTCTCGGAAGAAACGGGTTCTCGGGTCGGAT
CCCATCGGATCTTCTGAGGTTAAACGGACTCGAAGCGTTGAGTCTAAACGAGAATCGTCTCACCGGAGATATACCGTCGG
AGATAACGAAGCTAGCGAATCTCAGCGTTCTCAATCTCAGCTTCAACAGATTTTCCGGCGAGATTCCGAGCAATGTAGGC
GATTTAAAGAGCTTGAGTGTTTTAAACCTTAGTGGATGCGGGTTAACGGGTCGGATTCCGGTTAGTATCGCGGGTTTAAT
GAAGCTTCGGGTTTTGGATTTAAGTAAGCAGAGAATCTCCGGGGAGTTACCAGTTGAGCTCTTTGGCTTGCCTGATCTTC
AAGTGGTTGCTTTGGGACACAACGGTTTAAACGGTCTCGTACCGGAAGGTTTCAGCAGTTTGGTTAGTCTCCGGTTCTTG
AATCTTAGCTCCAATTTATTCTCCGGACGTATCCCTTCGAACTATGGGTTTCTCAAGTCGTTGGAAGTTCTTTCATTGTC
TCGTAACCGGATCTCCGGTTCTGTACCGGCGGAGATTGGGAATTGTTCCAGTCTTGAGGTTCTTGAGCTCGGTTCGAACC
GGTTAGAAGGTCACATTCCGGTTCGTCTTTCGAAATTGTCTCATCTGAAGAAGCTTGATTTGAGTCACAACAAGTTAACC
GGGGATATTCCGGTTCAGATGTCTAAGGACTCGTCTCTGGAGACTCTCCTGCTTAATTCGAACTCTCTATCGGGTCCTAT
ACCGGAATCTTTATCAAGATTGAGGAACTTAACCGGGTTGGATCTTTCATCAAACCGGTTTAACTCTACTATACCATCAA
CTCTCTCTCGGCTTCATTCTCTTAAGTACTTGAACCTGTCAAGAAACAGACTAGAAGGGGAGATCCCACAAGCTCTAGCT
GCACGTTTCAACAACACATCGGTCTTCTCCAATAACCCGAGGCTCTGCGGTAAACCGCTCGGTTTAGAATGTGAAAACGT
TAGGAGAAGGAGAAGAAGAAAGCTGATTCTACTCGTAACACTAGCCGCAGCTGGTGCATTGTTGTTGTTACTATGCTGCT
GCGGCTATGTGTTCAGTCTATGGAGATGGCGCAAGAAAATAAGATTAGGTTTGGGTTGGGACAAGAAAGGAACACCATCA
CGCACCTCCGGTACGAGCTCTGGCGGCACGAGGGGAGAGGACAACAACGGTGGTCCCAAGCTAGTGATGTTCAACAACAA
GATCACGTTAGCTGAAACCTTAGAAGCAACAAGACAGTTCGACGAGGAGAACGTACTGAGCAGAGGAAGATACGGTCTTG
TTTTCAAGGCGACTTTTAAAGACGGTATGGTTCTATCGGTACGTAGGCTCATGGACGGTGCGTCGATAACCGACGCAACG
TTCCGTAACCAAGCCGAGGCGTTGGGTAGAGTGAAGCACAAGAACATAACTGTCTTGAGAGGATACTACTGCGGACCGCC
TGATCTTAGACTTCTCGTTTATGACTACATGCCCAACGGAAACCTCTCGACGCTCTTGCAAGAAGCGTCTCACCAAGACG
GGCACGTGCTGAACTGGCCGATGCGTCATCTCATCGCGTTGGGGATCGCTAGAGGACTATCTTTCTTGCATTCGTTGTCC
ATCGTCCACGGGGACTTGAAACCGCAAAACGTACTTTTCGACGCGGATTTCGAAGCGCATTTGTCAGAGTTCGGGTTAGA
TAGACTGACGGCGTTAACTCCGGCTGAAGAACCGTCCACTTCGTCGACCCCGGTCGGGTCATTAGGCTACATTGCACCCG
AAGCGGGGTTAACGGGCCAAACGAGTAAAGAGAGTGATGTCTATAGCTTCGGGATCGTGTTGTTAGAGATCTTGACGGGT
AAAAAAGCGGTGATGTTTACGGAGGATGAAGACATAGTGAAATGGGTGAAGAGACAGTTGCAAAAGGGACAGATCGTTGA
GTTGCTTGAACCCGGTTTGTTGGAGCTTGACCCGGAGAGTTCGGAGTGGGAAGAGTTCTTGCTAGGGATTAAAGTTGGGT
TGTTGTGTACTGGTGGAGACGTTGTTGATCGACCTTCTATGGTTGATGTTGTGTTCATGCTCGAAGGGTGCAGAGTCGGT
CCAGCGATTTCCTTGTCAGCTGATCCTACTTCACCAGCCGCCGAAGCAGCTTCTTGA