Details for Chinese cabbage Locus Brara.G03360

Position : A07 ( 5`- 25534210 .. 25536193 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03360

Protein [Map View]
MSSMSRSRSPSRDRSRSRSPRDRRMRSERSSYRDAPYRRGDREPRRAFSQTNLCNNCKRPGHFARDCPNVSVCNNCGLPG
HIAAECTAESRCWNCREPGHVAGNCSNEGICHSCGKTGHRARDCTNPVSRAGDLRLCNNCFKPGHLAADCTNDKACKNCR
TSGHIARDCQNDPVCNICSISGHVARNCPKGDSSYSDRDRGSRARGGGMQRDGFGRMGRDGGMQRDGLSRGGRDGGGGVG
AMIICHNCGGRGHMAYECPSARIADRGSRRY*

DNA
ATGAGTTCAATGAGCAGGAGCAGGAGTCCCAGCCGTGACAGGAGCCGTAGTCGGAGCCCCAGAGACAGGAGAATGAGATC
TGAACGTTCTTCTTACCGTGATGCTCCTTATCGTAGGGGTGACCGTGAGCCACGCCGTGCTTTCAGCCAAACGAATCTCT
GCAATAACTGCAAGCGACCTGGTCACTTTGCAAGAGACTGTCCTAATGTCTCCGTCTGTAACAACTGTGGCCTTCCAGGG
CACATTGCAGCGGAATGCACTGCAGAGTCACGGTGCTGGAACTGCAGAGAGCCAGGCCACGTAGCAGGCAACTGTTCAAA
CGAAGGAATCTGCCACTCGTGTGGCAAAACCGGACACCGAGCAAGAGACTGCACGAACCCGGTTTCTCGTGCAGGAGACT
TGAGGCTCTGCAACAACTGCTTCAAACCGGGGCATCTCGCCGCCGACTGCACAAACGACAAGGCCTGCAAGAACTGCAGG
ACTTCAGGTCACATAGCTCGTGATTGCCAGAACGATCCGGTCTGCAACATCTGCAGCATCTCTGGACATGTTGCCAGAAA
CTGCCCAAAAGGGGACAGCAGTTACTCTGACCGAGACAGAGGAAGCAGGGCTCGAGGCGGTGGGATGCAAAGAGATGGTT
TTGGCAGAATGGGCAGAGACGGCGGCATGCAAAGAGATGGTTTGAGCCGAGGGGGCAGAGACGGCGGCGGCGGCGTTGGC
GCTATGATAATATGTCACAACTGTGGTGGCAGAGGACATATGGCTTATGAGTGCCCATCTGCTCGAATTGCTGACCGTGG
TTCCCGCCGTTACTGA