Details for Chinese cabbage Locus Brara.G03359

Position : A07 ( 5`- 25532578 .. 25533069 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03359

Protein [Map View]
MKPVSSLVIIFLLVLILQTNILESGHVRPNVQDAVKNNTDNNNTTTGVVLKDKKRSYNGGSGSYRWGWGGGGGGGGGGGG
GGGGGGRGWGWGGGGGGGGWYKWGCGGEERRKGREGRGEFVKREYAECKGNGKCRGKRLECPQHCGGFCFYDCLFLCKPH
CRR*

DNA
ATGAAGCCAGTTTCATCATTGGTAATTATCTTTCTTCTCGTACTGATCTTACAAACTAACATACTAGAGAGCGGGCATGT
CCGTCCCAATGTTCAAGACGCGGTCAAGAACAACACTGATAATAACAACACAACCACTGGAGTAGTTCTAAAGGACAAGA
AAAGAAGTTATAATGGAGGAAGCGGAAGCTATAGATGGGGATGGGGTGGTGGTGGCGGCGGCGGAGGGGGAGGTGGTGGT
GGTGGTGGCGGCGGCGGCAGAGGATGGGGATGGGGAGGAGGAGGAGGTGGTGGAGGATGGTACAAATGGGGTTGTGGAGG
AGAAGAAAGAAGAAAAGGAAGAGAGGGAAGAGGAGAGTTTGTGAAAAGAGAATATGCGGAGTGCAAAGGAAACGGGAAAT
GTAGAGGAAAGAGATTAGAATGTCCTCAACATTGTGGAGGTTTTTGTTTCTATGATTGTCTCTTTCTCTGCAAACCACAT
TGCCGTCGCTAG