Details for Chinese cabbage Locus Brara.G03357

Position : A07 ( 5`- 25523068 .. 25524632 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03357

Protein [Map View]
MKIRCDVCDKEEASVFCTADEASLCDGCDHRVHHANKLASKHLRFSLLYPSSSKNSSPICDICQEKKALLFCQQDRAILC
KDCDSSIHSANEHTKKHDRFLLTGVKLSPTSSVYKPTTESPSSSQDCSVPSPLKKPISAPQSQIKNSKIQPSKISSDVGV
NQWGSTSTISEYLIDTLPGWHVEDFLDSSLPPFGFSKSGDDDGVLPFMEAEDDSTKRNNNNTVSLPSKNMGIWVPQIPQT
LPSSYTNQYFPHDNNNIQFGMYNNKETSHGVDTYAPIQNMKQQGQNKRWYDDGGFTVPQMTTTTTSTFTPLASNKRSRSF
W*

DNA
ATGAAGATCAGGTGCGACGTCTGCGATAAAGAAGAAGCCTCGGTGTTCTGCACCGCTGACGAAGCGTCTCTATGCGACGG
CTGCGATCACCGAGTCCACCACGCTAACAAACTCGCCTCAAAACATCTCCGTTTCTCTCTCCTCTATCCTTCTTCCTCCA
AGAACTCCTCTCCTATCTGCGACATCTGTCAGGAGAAGAAGGCTCTCTTGTTTTGCCAACAAGATAGAGCTATTTTATGC
AAAGACTGTGATTCATCGATCCACTCGGCGAACGAACACACCAAGAAACACGATAGGTTTCTTCTCACAGGGGTTAAGCT
ATCTCCAACCTCCTCTGTCTACAAACCAACTACAGAATCTCCTTCAAGTAGTCAAGATTGTTCTGTCCCTTCTCCTCTCA
AGAAACCTATCTCAGCTCCTCAGAGTCAGATCAAGAACTCCAAGATCCAACCCTCTAAGATCAGTAGCGACGTAGGGGTG
AATCAGTGGGGATCCACAAGCACGATTTCAGAGTATCTGATCGATACGTTACCTGGTTGGCACGTTGAGGATTTTCTTGA
TTCCTCACTTCCTCCTTTTGGTTTCTCTAAGAGTGGTGATGATGATGGAGTGTTACCATTTATGGAAGCAGAAGATGACA
GCACTAAGAGAAACAACAACAATACAGTGTCACTTCCGTCTAAGAATATGGGGATTTGGGTCCCTCAGATTCCACAAACT
CTTCCTTCCTCCTACACAAACCAGTACTTTCCTCATGATAACAACAATATTCAGTTTGGGATGTACAACAACAAAGAAAC
ATCACATGGAGTAGACACTTATGCTCCAATACAAAACATGAAACAACAAGGACAGAACAAGAGATGGTATGATGATGGTG
GCTTCACTGTCCCACAGATGACTACTACTACTACTTCTACTTTTACTCCTCTTGCGTCTAATAAAAGGTCCAGATCCTTC
TGGTAA