Details for Chinese cabbage Locus Brara.G03351

Position : A07 ( 5`- 25441338 .. 25443728 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03351

Protein [Map View]
MASSGAPSHKALSKIACKRLQKELVEWQMNPPTGFKHKVTDNLQRWIIEVIGAPGTLYANETYQLQVDFPEHYPMESPQV
IFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTEKQRPTDNDRYVQNCKNGRSPKETRWWFHDDK
V*

DNA
ATGGCAAGTTCTGGTGCTCCTTCTCACAAGGCTCTGAGCAAAATCGCGTGTAAAAGGCTTCAGAAAGAGCTTGTGGAATG
GCAGATGAATCCACCTACGGGGTTCAAACACAAGGTCACTGATAATCTCCAGAGATGGATAATTGAAGTTATTGGAGCAC
CAGGAACTTTGTACGCGAACGAGACCTATCAGCTTCAAGTTGATTTTCCCGAGCACTATCCTATGGAATCGCCGCAAGTG
ATCTTTCTCCCTCCGGCTCCTTTGCATCCTCACATTTACAGCAATGGGCATATTTGCTTAGATATTCTGTATGATTCGTG
GTCTCCAGCGATGACTGTTAGTTCTATCTGCATCAGCATCCTCTCCATGCTCTCTAGCTCGACTGAAAAGCAACGACCGA
CCGATAATGACCGATATGTGCAGAATTGTAAGAACGGAAGATCTCCAAAGGAGACGAGATGGTGGTTCCACGATGATAAA
GTATAA