Details for Chinese cabbage Locus Brara.G03346

Position : A07 ( 5`- 25412731 .. 25413104 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03346

Protein [Map View]
MSPVISEALRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFSEIISPLAITYSL*

DNA
ATGTCTCCAGTGATTAGCGAAGCACTTAGATCTGGCTTAACTATAGATTCATCTCTTAGACGCAGGACCCATCTTGTTCA
ATCTTTCTCCGTCGTTTTTCTTTACTGGTTCTATGTTTTCTCAGAAATCATCTCTCCTTTAGCCATAACATATAGCCTAT
AA