Details for Chinese cabbage Locus Brara.G03345

Position : A07 ( 5`- 25397562 .. 25398722 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03345

Protein [Map View]
MTKKKQLDDVEAEKAEAMRRYNNQKRLRNIVRAAALSFFCYLWFPTLQAACDWFNRTGPVINLTNRALVFFFVNVLVGSI
FLLSRDHGEEESGSVRTNEPDLYDQYTSFSAVTVAVTASDDDDSKKKIVPTFITEVHEEVVAEKQIVSAEEVVVVEAVTT
ENKAIRPATEFRRTESERKKENKSQVTKIRRTESANSAIDRLNSEEFRLKVEAFIMEKKRCLVQEENDVVGWREDGSSGL
ELVGADSI*

DNA
ATGACGAAGAAGAAGCAGCTCGATGACGTGGAGGCGGAGAAAGCGGAAGCGATGAGGAGATACAACAACCAGAAACGTCT
CAGGAACATCGTACGAGCAGCCGCCCTATCTTTCTTCTGCTACTTGTGGTTTCCCACGCTACAAGCTGCCTGCGATTGGT
TTAACCGAACCGGACCGGTTATTAATTTAACCAACCGCGCGCTCGTTTTCTTCTTCGTTAACGTACTCGTCGGTTCCATC
TTCCTTCTATCTCGCGATCACGGCGAGGAAGAGAGTGGGAGTGTTAGGACCAACGAGCCAGATCTATACGATCAGTACAC
CTCCTTCTCCGCCGTAACCGTAGCCGTAACCGCCTCCGATGATGATGATTCGAAAAAGAAAATCGTTCCGACGTTTATCA
CGGAGGTCCACGAGGAGGTGGTTGCGGAGAAGCAAATCGTTTCGGCGGAGGAGGTGGTGGTTGTAGAGGCGGTTACAACG
GAGAATAAGGCTATCCGGCCGGCGACGGAGTTTAGGAGGACTGAGTCGGAGAGGAAGAAGGAGAATAAGAGTCAGGTGAC
GAAGATTCGGAGGACTGAGTCGGCGAACTCGGCGATCGATAGGTTGAACAGCGAGGAGTTTCGTTTGAAGGTGGAGGCGT
TTATAATGGAGAAGAAGAGATGTCTTGTTCAGGAGGAAAACGACGTCGTTGGATGGCGAGAAGATGGTTCTTCTGGACTT
GAGCTCGTTGGTGCTGACTCTATCTAA