Details for Chinese cabbage Locus Brara.G03338

Position : A07 ( 5`- 25361641 .. 25362959 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03338

Protein [Map View]
MASNSRSSSWTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKSAEEVKRHYDILVEDLINIETGRVPLPNYKTFESNSR
GINDFNTRLMKNLKI*

DNA
ATGGCGTCAAACTCTAGAAGCTCGTCATGGACGTTTAAGCAGAACAAGATGTTCGAGAGAGCCTTGGCAGTTTACGACAA
GGACACACCAGACCGATGGCACAATGTAGCAAAAGCTGTCGGAGGGAAATCTGCAGAGGAAGTGAAGCGTCACTATGACA
TCCTCGTCGAAGATCTCATCAACATCGAAACTGGTCGTGTCCCTTTGCCCAACTACAAGACATTCGAATCTAACTCCAGA
GGCATCAATGACTTCAACACGAGGCTAATGAAAAATTTGAAGATCTAA