Details for Chinese cabbage Locus Brara.G03336

Position : A07 ( 5`- 25348240 .. 25351539 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03336

Protein [Map View]
MSDTEEARNNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDLGL
TVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMFAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVY
IAEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGTLPCIVLIPGLFFIPESPRWLAKMGMTDDFETSLQV
LRGFETDITVEVNEIKRSVASSTKRSSTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGINGVLFYSSTIFESAGVTSSNAA
TFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKGFVSHDSDMYSMLSILSVVGVVAMVVSFSLG
MGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYAVVCAFTVVFVTLWVPETKGKTLEE
LQALFR*

DNA
ATGAGTGATACAGAGGAGGCCAGGAATAATGATCTGCGACGACCTTTCATACACACGGGAAGCTGGTACCGGATGGGCTC
AAGACAATCGAGCATGATGGGTTCGTCTCAAGTCATCAGAGACAGCTCTATCTCTGTTCTTGCTTGTGTCCTGATCGTTG
CTCTTGGTCCTATTCAATTCGGTTTCACTTGTGGTTATTCTTCTCCGACACAAGCTGCAATCACTAAGGATCTCGGTTTA
ACTGTATCCGAGTACTCTGTGTTTGGTTCTCTATCCAATGTGGGAGCTATGGTTGGTGCAATTGCCAGTGGTCAGATTGC
AGAATACATTGGAAGAAAAGGGTCTCTGATGTTTGCTGCTATTCCCAATATCATTGGCTGGCTTTGCATATCATTTGCTA
AAGATACTTCTTTTCTGTACATGGGAAGACTTTTAGAAGGCTTTGGTGTTGGGATCATATCTTACACAGTGCCTGTGTAT
ATCGCTGAGATAGCTCCACAGAATATGAGGGGAGGACTGGGTTCAGTTAACCAGCTTTCTGTGACAATTGGAATAATGTT
GGCATATTTACTTGGCCTCTTTGTTCCATGGAGGATTCTTGCAGTTTTGGGGACATTGCCATGCATAGTATTGATACCAG
GTCTCTTCTTCATTCCTGAATCCCCTCGCTGGCTGGCAAAAATGGGTATGACTGATGATTTTGAAACTTCGTTACAAGTT
CTTAGAGGATTTGAGACTGATATTACCGTTGAGGTTAATGAAATCAAGAGATCAGTGGCATCATCTACTAAGAGATCATC
TACAGTTCGGTTTGTAGATCTCAAGAGGAGGAGATACTATTTCCCACTTATGGTTGGTATAGGGTTGCTTGTACTTCAAC
AACTCGGTGGGATTAACGGCGTTTTATTCTATTCCAGTACTATCTTTGAATCTGCAGGAGTTACATCGAGTAATGCAGCA
ACATTTGGGGTCGGTGCTATTCAAGTAGTGGCGACTGCAATATCAACATGGTTGGTGGACAAAGCAGGTCGTCGCCTTCT
GCTTACCATCTCTTCGGTTGGGATGACGATCAGTTTAGTAATTGTTGCAGCTGCTTTCTACCTTAAGGGATTTGTGTCTC
ATGATTCAGACATGTACAGTATGCTGAGCATCTTATCTGTAGTTGGAGTTGTGGCAATGGTTGTTTCTTTCTCATTAGGA
ATGGGACCAATTCCGTGGCTCATTATGTCTGAGATCCTTCCTGTAAACATAAAGGGCTTAGCTGGAAGTATAGCGACTTT
AGCAAATTGGTTCTTCTCTTGGTTGATCACCATGACTGCAAACTTGCTCTTGGCCTGGAGCAGTGGAGGAACTTTCACTC
TATACGCGGTGGTGTGTGCATTCACAGTGGTGTTTGTAACTTTATGGGTTCCTGAGACCAAAGGGAAAACACTTGAGGAA
CTTCAAGCCTTGTTCAGATGA