Details for Chinese cabbage Locus Brara.G03335

Position : A07 ( 5`- 25343597 .. 25348174 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03335

Protein [Map View]
MLLNKRHFSLCVSLFSSCAQRQLLNSSAGTSHICFKSSMEEQRASGLTDSVVQFQNVGSRDGCEAPHKWSSNGGGKKIDV
RNQIFCNRSLNMKNIIAVGFDMDYTLAQYKSETFESLAYEGTVRKLVYDLGYPRELLEWTFDWNYMVRGLVLDKKKGNIL
KMDRHKYVKVAYHGFKELSKEEKVDVYGTSLVRDSFDEPDYALIDTLFSLAEAYLFAQLVDFKDNNPDKIPKDADYGRMY
KDVRSAVDMCHRDGTLKQMVAKEPNKYINEDATIVPLIKMIRDSGRSTFLVTNSLWDYTNIVMNFLCGGRTVHGPDTCNF
DWLQYFDVVITGSAKPGFFHEESRANLFEVELKSGMLINTDNGTPMAQIGDPSPKIPLKSKDKACQVFQGGNVGHLHNLL
SIESSSQVLYVGDHIYGDILRSKKVLGWRTMLVVPELEKEVELLWELRDARKELILMRNERDSVEDMIHHLSWSLKFEDI
NEKDKQEMLSTVKDLVCKRDEVRLNLQEAQRESHKKFHNVWGQLMKTGYQSSRFAHQVERFACLYTSQVSNLRLYSPDKY
YRPSEDFMSHEFHLLPL*

DNA
ATGCTTCTCAACAAGCGTCATTTCTCTCTCTGTGTCTCTCTGTTCTCTTCTTGTGCACAAAGACAGTTACTCAATTCTTC
TGCTGGGACAAGTCATATCTGTTTCAAAAGTTCAATGGAAGAACAAAGAGCTAGTGGTCTTACGGACAGCGTGGTGCAGT
TTCAAAATGTGGGATCAAGGGACGGATGTGAAGCTCCCCATAAGTGGTCATCCAATGGAGGAGGAAAGAAAATCGACGTA
AGAAACCAGATCTTCTGCAATAGATCTTTGAACATGAAGAATATCATTGCCGTAGGCTTTGATATGGACTATACTCTGGC
CCAATATAAGTCCGAAACTTTTGAGTCCCTTGCATATGAAGGCACTGTCAGGAAGCTGGTATACGATTTGGGGTATCCAA
GAGAGCTGCTGGAATGGACATTTGATTGGAACTATATGGTTAGAGGGTTGGTTCTAGACAAAAAGAAAGGAAACATCTTA
AAGATGGATCGCCATAAGTACGTGAAGGTGGCTTACCATGGGTTTAAGGAGCTCTCTAAGGAGGAAAAAGTTGATGTCTA
TGGCACTAGCCTAGTACGAGATTCTTTTGATGAGCCTGACTACGCTCTCATTGATACTCTCTTCTCTTTGGCCGAAGCCT
ATCTCTTTGCCCAACTCGTCGACTTCAAAGATAATAACCCTGATAAAATCCCCAAGGACGCTGATTATGGTCGCATGTAT
AAAGATGTCCGGTCTGCTGTTGATATGTGCCACCGTGACGGAACATTGAAGCAAATGGTTGCAAAGGAACCTAATAAGTA
TATCAACGAGGATGCTACCATTGTACCTCTGATAAAAATGATAAGAGATTCCGGACGCTCAACATTCTTGGTGACCAATA
GTTTGTGGGACTACACAAATATTGTGATGAACTTTCTCTGTGGAGGCCGCACTGTACATGGTCCTGATACTTGCAACTTT
GACTGGCTCCAATACTTTGATGTTGTGATCACTGGCAGTGCAAAACCTGGTTTCTTCCATGAGGAGAGCCGTGCCAACCT
TTTTGAGGTGGAACTTAAGTCAGGGATGCTGATCAATACGGACAATGGAACACCTATGGCTCAGATTGGAGATCCTTCAC
CAAAAATTCCACTGAAGAGTAAAGACAAAGCGTGTCAAGTTTTCCAAGGTGGAAATGTTGGTCATCTTCACAATTTGCTC
TCCATCGAGTCAAGTTCTCAGGTCCTTTACGTTGGCGATCACATATACGGTGACATCTTGCGCAGCAAAAAAGTCCTCGG
GTGGAGAACTATGCTGGTTGTACCGGAACTTGAAAAGGAGGTTGAACTTCTGTGGGAGCTTAGGGACGCGCGTAAGGAAC
TAATTTTGATGAGGAATGAGCGTGACTCAGTGGAAGACATGATCCACCACTTGAGCTGGTCTCTGAAGTTTGAAGATATC
AACGAGAAAGACAAGCAGGAAATGCTATCAACGGTTAAGGACTTAGTGTGTAAAAGAGATGAAGTACGACTAAATCTTCA
AGAAGCTCAAAGAGAAAGCCACAAAAAGTTTCACAATGTCTGGGGGCAATTAATGAAAACTGGTTACCAAAGTTCTAGAT
TTGCTCACCAGGTGGAGAGATTTGCATGCCTATACACGAGCCAGGTCTCTAACCTGCGGTTATACTCCCCAGACAAATAC
TACAGGCCAAGTGAGGACTTCATGTCCCACGAGTTCCACCTTCTTCCCCTTTGA