Details for Chinese cabbage Locus Brara.G03334

Position : A07 ( 5`- 25340325 .. 25343346 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03334

Protein [Map View]
MASSSSIHARLALVALLSATTFYCIHKYRRLKRLKTLSLNPSSRRGKIFFISQTGTSKSLAQRLHKLLESNGIAFDLVDP
ASYEPEDLPKETLAIFVASTWDGGKPPKDGEFLVDWLSESAEDFRVGSLLLSCCRFGVFGVGSRAYGDEYNAVAKELSRR
MVGLGGAEMVPLGEGDVDDGELDRAFNEWCDGVIRVLKGGSAQAREANEITQNGVVESEEEYIDTTDEEEEEDSNDIVDL
EDIAGKAPSRKNGVVKVTKRGDGKKEMVTPVIRASLTKQGYKIIGSHSGVKICRWTKSQLRGRGGCYKHSFYGIESHRCM
ETTPSLACANKCVFCWRHHTNPVGKSWQWKMDDPKEIVKGALDLHTKMIKQMKGVPGVTPEKLQEGLTPRHCALSLVGEP
IMYPEINALVDELHGKRISTFLVTNAQFPEKILMMKPITQLYVSVDAATKESLKAIDRPLFADFWERFIDSLKALQEKQQ
RTVYRLTLVKGWNTEELEAYFNLFSIGKPDFIEIKGVTYCGSSATSKLTMENVPWHADVKAFSEALSLKSNGEYEVACEH
AHSCCVLLGRTDKFKVDGKWFTWIDYEKFHDLVASGEPFTSRDYMAETPSWAVYGAEEGGFDPEQLRYKKERHHHPKPQA
VVA*

DNA
ATGGCTTCGTCGTCCTCCATTCACGCTCGACTAGCTCTCGTAGCTCTACTCTCAGCGACTACCTTCTACTGCATCCACAA
ATACCGCCGCCTGAAACGTCTCAAAACCCTCTCCTTAAACCCTAGCAGCAGAAGGGGAAAGATCTTCTTCATCTCCCAAA
CGGGAACATCCAAATCCCTAGCTCAGCGTCTCCACAAGCTCCTGGAATCGAACGGCATCGCGTTCGATCTCGTCGATCCA
GCTAGCTACGAGCCGGAGGATCTCCCCAAGGAGACGCTAGCCATCTTCGTCGCGTCGACGTGGGACGGCGGGAAGCCGCC
CAAGGACGGGGAGTTTCTCGTCGACTGGCTTTCGGAGAGCGCGGAGGATTTCAGAGTCGGATCGCTTCTTCTCTCCTGTT
GCAGATTCGGAGTCTTCGGCGTCGGGAGCCGTGCTTATGGTGATGAGTATAACGCGGTGGCGAAGGAGCTGTCGAGGAGG
ATGGTGGGGTTGGGTGGAGCGGAGATGGTGCCGTTGGGAGAAGGTGACGTGGACGATGGAGAGTTAGATAGAGCGTTTAA
CGAGTGGTGTGATGGTGTGATTAGAGTTCTCAAGGGAGGCTCTGCTCAGGCTCGGGAAGCTAATGAGATTACTCAAAACG
GTGTCGTTGAGAGTGAAGAGGAATATATTGATACAACAGATGAAGAGGAAGAAGAAGATAGCAATGATATTGTTGATCTT
GAAGATATTGCTGGAAAAGCTCCTTCTAGGAAGAACGGTGTTGTTAAGGTTACGAAACGTGGTGATGGGAAGAAGGAGAT
GGTGACTCCTGTGATTAGAGCTAGCTTAACGAAACAGGGGTATAAGATCATTGGTTCGCATAGTGGGGTTAAGATTTGTA
GATGGACGAAGTCACAGCTTAGAGGCAGGGGAGGTTGTTACAAGCACTCCTTTTATGGCATTGAGAGTCACAGGTGTATG
GAGACAACACCTAGTTTAGCATGTGCGAACAAATGTGTCTTCTGTTGGAGGCATCACACTAATCCTGTGGGGAAGAGCTG
GCAGTGGAAGATGGACGATCCTAAAGAGATTGTGAAAGGTGCTCTTGATCTTCATACAAAGATGATTAAACAGATGAAAG
GAGTTCCAGGTGTAACTCCAGAGAAGTTACAAGAAGGTCTAACACCAAGGCATTGTGCGTTATCACTTGTTGGTGAGCCA
ATCATGTATCCAGAGATCAATGCCCTTGTGGATGAGCTTCATGGAAAGCGTATTTCCACATTCTTGGTTACTAATGCCCA
ATTCCCTGAAAAGATTTTGATGATGAAGCCTATCACCCAGTTGTACGTAAGTGTAGATGCTGCCACCAAAGAGAGCTTGA
AGGCTATTGATAGGCCTCTCTTTGCGGACTTCTGGGAGCGATTTATTGACTCCTTGAAAGCTCTCCAAGAGAAGCAGCAG
CGAACAGTCTATCGTTTAACACTTGTCAAAGGATGGAACACAGAAGAGCTAGAAGCTTATTTCAATCTCTTTAGCATCGG
GAAACCAGACTTCATTGAGATCAAAGGCGTCACATATTGTGGATCATCTGCAACATCAAAGTTGACAATGGAGAACGTAC
CGTGGCACGCGGATGTTAAAGCATTCTCAGAAGCTCTGTCTCTAAAGAGCAATGGAGAGTACGAGGTTGCTTGCGAGCAC
GCCCATTCTTGCTGTGTTCTTCTAGGGAGAACCGACAAGTTCAAAGTGGATGGGAAGTGGTTCACCTGGATCGACTACGA
AAAGTTCCACGATCTGGTGGCTTCTGGAGAACCGTTCACGAGTAGGGACTATATGGCTGAAACACCATCATGGGCAGTTT
ATGGAGCAGAGGAAGGTGGGTTTGATCCAGAGCAGTTGCGTTACAAGAAAGAAAGGCATCATCACCCTAAACCACAGGCT
GTTGTAGCTTAA