Details for Chinese cabbage Locus Brara.G03332

Position : A07 ( 5`- 25335485 .. 25338058 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03332

Protein [Map View]
MEEPYETRNNEPYQMVRYHQGYNRTLTPPLLDLRVFYVRISNFKADDSTPEVLTLTHIPLDPDSLLENNGVRYSQGVSSQ
LRQDRVDKRSEAVTYISTDNIRLSGSVRFEVYDRDEMVLSGTLELSGSNGFTGESVKHGVKRWGMNCEAEITAGCGFLKE
KKKHIGCSEMSSSPLLPTVEVYVTGCFSGTPIILTKTLQLGFRKKMHNRVAALDSIPEYETGETHKGNSSELDFQVTEYG
SYKQDYEGEYGDMYMGREYADVEDGEMSWFNAGVRVGVGIGLGVCVGLGIGVGLLVRTYQSTTRNFRRRLI*

DNA
ATGGAGGAGCCTTACGAGACACGCAACAATGAACCATATCAGATGGTTAGATATCATCAGGGCTACAACAGAACATTAAC
ACCACCATTGTTGGATTTGAGAGTGTTCTATGTCAGAATCAGCAACTTCAAGGCGGATGATTCCACACCTGAGGTCCTCA
CCCTCACCCACATCCCTCTGGATCCTGACTCGCTCCTCGAGAACAACGGTGTTCGATACTCTCAAGGAGTTTCCTCTCAG
CTGAGGCAAGACCGTGTTGATAAGAGATCAGAAGCGGTTACTTACATCAGCACAGACAATATAAGGCTATCCGGTAGTGT
GAGGTTTGAGGTGTATGACAGAGATGAGATGGTTTTGTCTGGGACGTTAGAGTTGTCTGGGAGTAATGGTTTCACAGGGG
AGTCTGTTAAGCATGGCGTGAAGCGGTGGGGGATGAACTGTGAAGCTGAGATCACTGCAGGGTGTGGTTTCTTGAAGGAG
AAGAAGAAACACATTGGTTGTTCCGAGATGTCATCATCTCCGTTGTTGCCGACTGTTGAAGTGTATGTCACTGGTTGCTT
CTCGGGAACACCTATCATCTTGACCAAGACGCTTCAGCTTGGTTTTAGGAAGAAGATGCATAATAGAGTGGCTGCGTTAG
ATTCGATTCCTGAGTATGAAACCGGCGAGACTCATAAAGGCAACTCGTCTGAGCTTGATTTTCAGGTAACAGAATACGGA
AGCTATAAACAAGACTATGAAGGAGAATACGGGGACATGTATATGGGAAGAGAGTACGCAGATGTTGAAGATGGCGAAAT
GTCTTGGTTCAATGCTGGTGTGAGGGTTGGTGTTGGAATTGGTCTTGGCGTCTGTGTAGGTCTCGGCATTGGTGTTGGCC
TTCTGGTGCGAACCTATCAATCAACCACCAGAAACTTCAGAAGAAGACTCATCTAG