Details for Chinese cabbage Locus Brara.G03331

Position : A07 ( 5`- 25331657 .. 25333379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03331

Protein [Map View]
MFRRKTTSQAEQENNEAALREAKIKEVKTLIGELSGRSSLYCSDPCLKRYLEARNWNVGKAKKMLEETLKWRSTFKPEEI
RWDEVSGEGETGKVYKAGFHDRSGRTVLILRPGLQNTKSLENQMKHLVYLIENAIMNLPEDQEQMSWLIDFTDWSLSTSV
PIKSARETINILQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFIKVKFVYPKNPESVELMSSFFDEENLPTEFGG
KALLQYNHEEFSKQMNQDDVKTADFWELVHSNNNHQQQSSSGFSGAEIAPEPIQTNT*

DNA
ATGTTTCGCCGCAAGACTACTTCGCAAGCTGAACAAGAGAATAATGAAGCAGCTCTCAGAGAGGCAAAGATCAAAGAGGT
CAAGACTCTCATAGGTGAGCTCTCTGGAAGGAGTTCACTCTACTGTTCAGATCCCTGTCTCAAGAGATATCTTGAAGCTA
GGAACTGGAACGTTGGCAAAGCCAAGAAGATGCTTGAAGAGACGCTGAAATGGAGATCAACCTTCAAACCTGAAGAGATC
CGTTGGGATGAAGTTTCAGGTGAAGGTGAGACTGGGAAGGTTTACAAAGCTGGATTCCATGACAGAAGTGGAAGAACTGT
TCTTATCCTCAGACCTGGCTTGCAGAACACCAAGTCTTTGGAGAACCAGATGAAACATTTAGTGTATCTCATTGAGAATG
CTATTATGAATCTTCCGGAGGATCAAGAACAGATGTCTTGGCTCATTGATTTTACAGACTGGTCGCTGAGCACCAGTGTG
CCTATCAAATCCGCCAGGGAAACTATCAACATACTGCAGAATCACTACCCTGAGAGACTAGCTGTCGCTTTCCTCTATAA
TCCTCCAAGGCTCTTTGAGGCATTCTGGAAGATAGTGAAGTACTTCATTGATGCAAAGACATTCATCAAGGTGAAGTTTG
TTTACCCGAAGAACCCTGAAAGCGTGGAGCTTATGAGCTCATTTTTCGACGAGGAGAACCTCCCAACGGAGTTTGGAGGG
AAGGCTTTGTTGCAGTATAACCATGAAGAGTTCTCTAAGCAAATGAACCAAGACGATGTTAAAACTGCAGACTTTTGGGA
ATTGGTTCATAGTAACAACAATCACCAGCAGCAGTCCAGCAGTGGATTTTCTGGAGCTGAGATTGCTCCTGAGCCAATAC
AAACCAACACTTAA