Details for Chinese cabbage Locus Brara.G03329

Position : A07 ( 5`- 25321527 .. 25325950 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03329

Protein [Map View]
MVSEKQLSPIGGSSVPVPNRMLRLLKKATSISDLCPGSVEADGEDLEKDGIEEDEMRSDLEGLGVEDGVHARKALDFDSV
PELNPAIEDFGEKSEEVISEMETREETRVSESSVPEIDPASDETREEGEEEIPEMETRFSESSVLEVDPASEELGEKSEE
EIPEMETREETRVSESSECEESGEKGEDEVSEMETEEEINGWGSKGVRKKRQVLEAGDSQGKEAKRNNKKSKKTTVDFDE
LPASMNMTKKERREYLDQLRAENQRLLRETRDAAFEPVPLVRKPISSVLEKIRRRKEEISKQFLSRKKSKSKDLYDGAPY
GEEVVMEEKDEDVNLEFTSNQNPDGEDSLEDSAAPLGNSDSPSNKNAESNPTQQDPSLGSQTTSSGEEHLEKTSTRSVDE
VMTPPSVLASNLKRNPSPAPDNSEEAEYTKESYDPETHDSSPGDPVRKFIDEVAEEEDDSDNDLLRFEDDDEDEDEEDDD
LRDMIASQFKEDPSDKYKRNELHQKWLEQQDAAGTEKLLHKLKRGLQQDETSLFEDEDDNADDENMAEDEEVTKPEASED
ENEEDPSHATSMRMRIKKIKEMIPLMFTDKDDVYVSSDDEETEKKLMQQRLYKKRLEQKAKLSSSTGNEHSEEILRHIKK
PEIGKKAKTTSFKDRALMGINKNPAASKSSFLGKLTKSSISEGSRKRGSNVVRGYIFERDDSNSKSSNSVPEEPSVPETI
VQEKSRPRRAPAKFTASQSQERSTTSPASAAEEKSTRQRTTLYEILKMSSKKTSFTSGETVISSSHTESIFAAFKLDTKP
LKTNPQAQR*

DNA
ATGGTTAGCGAGAAGCAGCTTTCTCCAATCGGAGGATCGAGTGTCCCGGTTCCGAACAGGATGCTTAGGCTATTGAAGAA
GGCTACGTCGATCTCCGATCTATGTCCTGGTTCCGTAGAAGCCGACGGTGAAGATTTGGAGAAGGATGGAATCGAAGAAG
ACGAGATGCGATCTGATTTAGAAGGTTTGGGTGTGGAGGATGGAGTTCACGCGAGGAAGGCTCTCGACTTCGATTCCGTG
CCTGAGCTTAATCCAGCGATTGAGGATTTTGGAGAGAAAAGTGAAGAGGTAATCTCTGAAATGGAAACGAGAGAGGAAAC
TAGGGTTTCGGAATCGAGCGTGCCTGAGATCGATCCCGCATCTGATGAAACGCGCGAGGAAGGCGAAGAGGAGATCCCTG
AAATGGAAACTAGGTTTTCGGAATCGAGTGTACTTGAGGTCGATCCCGCATCTGAGGAATTGGGAGAGAAGAGTGAAGAG
GAGATCCCCGAAATGGAAACAAGAGAGGAAACAAGGGTTTCGGAATCGAGTGAATGTGAGGAATCGGGGGAGAAAGGCGA
AGACGAAGTCTCTGAAATGGAAACAGAGGAGGAAATCAATGGTTGGGGATCCAAGGGAGTTAGAAAGAAGCGACAAGTTC
TCGAGGCCGGTGATAGCCAAGGAAAGGAGGCGAAGAGAAACAACAAGAAGAGCAAGAAGACTACTGTTGATTTTGATGAG
CTGCCTGCTTCCATGAACATGACTAAGAAGGAACGAAGAGAGTATCTTGACCAGCTTCGTGCAGAAAACCAGAGACTCTT
GCGAGAAACTCGAGATGCTGCCTTTGAACCCGTCCCTCTTGTGCGTAAGCCCATTTCCTCTGTCTTGGAGAAGATTCGAC
GAAGGAAAGAGGAGATTTCTAAGCAGTTCCTTAGCCGGAAGAAATCCAAATCAAAGGACTTATATGACGGTGCTCCTTAT
GGGGAGGAAGTTGTAATGGAAGAGAAGGATGAAGATGTGAATTTGGAATTTACAAGCAACCAAAACCCTGACGGAGAGGA
TTCCTTGGAGGACTCTGCTGCTCCATTGGGGAACTCAGACAGTCCATCTAACAAAAACGCTGAAAGTAACCCTACTCAGC
AGGATCCATCCTTGGGCTCTCAAACTACTAGTTCTGGAGAAGAACATCTAGAGAAGACATCAACCAGATCCGTGGATGAA
GTGATGACACCACCATCGGTGCTTGCAAGTAACCTCAAACGAAACCCGTCTCCAGCCCCTGACAATTCTGAAGAAGCAGA
GTACACTAAGGAAAGTTATGATCCTGAGACCCATGATTCATCTCCTGGAGACCCTGTGAGAAAATTTATTGATGAGGTTG
CTGAAGAGGAAGATGACAGCGACAACGATTTACTCCGGTTCGAAGATGATGATGAAGACGAGGACGAAGAAGATGACGAT
CTCAGGGATATGATTGCCAGTCAATTTAAGGAAGATCCAAGCGACAAATATAAACGTAATGAACTGCATCAGAAGTGGCT
TGAGCAACAAGATGCTGCAGGGACAGAGAAGCTCTTACATAAGCTAAAACGAGGTCTGCAGCAGGACGAAACATCATTGT
TTGAAGATGAAGACGATAACGCTGATGATGAAAATATGGCTGAAGATGAAGAAGTGACAAAACCTGAAGCCAGTGAAGAT
GAAAACGAAGAAGATCCGAGTCATGCAACTTCCATGCGAATGAGGATAAAGAAAATAAAAGAAATGATCCCTTTAATGTT
CACAGATAAAGATGACGTTTATGTGTCATCTGACGATGAGGAAACGGAGAAGAAGCTCATGCAACAGCGATTGTACAAGA
AAAGATTGGAGCAAAAGGCCAAGCTTTCATCATCTACCGGGAATGAACACTCTGAGGAAATTCTTCGCCACATCAAGAAG
CCTGAGATAGGAAAGAAAGCAAAAACTACTTCTTTTAAAGATAGGGCACTCATGGGAATAAACAAAAACCCCGCTGCATC
CAAGTCATCGTTCTTGGGTAAACTTACAAAGAGTTCTATATCAGAAGGATCTCGTAAGCGCGGGTCAAACGTTGTCCGTG
GCTATATATTCGAACGTGATGACAGTAACAGCAAAAGCTCAAACTCAGTGCCAGAGGAACCTTCAGTTCCAGAGACGATT
GTTCAAGAAAAGAGCCGACCAAGAAGAGCTCCAGCAAAATTCACCGCCTCACAGTCACAGGAGAGATCAACAACTTCACC
GGCATCAGCGGCAGAGGAGAAGAGCACGAGGCAGCGAACAACCTTGTACGAGATTCTAAAGATGTCTTCAAAGAAAACTA
GCTTCACTTCAGGGGAGACGGTGATAAGTAGCAGCCACACTGAGTCTATATTTGCTGCCTTCAAGCTGGATACGAAACCA
CTTAAGACAAATCCACAAGCACAGAGATGA