Details for Chinese cabbage Locus Brara.G03328

Position : A07 ( 5`- 25318984 .. 25321333 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03328

Protein [Map View]
MAVPFVFFLFLFLLIFRFVYTNLWIPWRLQSHFNKLHLTGPRYRLFTGNSSEVTRLTTEAKSKPIPSGDNPHEFVHRVAP
HYHKWSRAYGKTFLYWFGTKPVVATSDPKLIREALKSKSFDRIGHNPLSKLLYAQGLPGLRGDQWAFHRRIAVQAFTMDK
VKRWVPQMVASTKMFIEKWEEIRNGEEEIELDVHREVHSLSAHMLSRTAFGNNVEEGKRIFALQERMMRLFYLVRWSIYI
PGYRFLPSKTNREIWRIEKQIRGSILGLIEKNKTRDAEIAGTLLQAFMSPYVNHNGQEERLGIEEVIDECKTFYFAAKET
TGDLMTWVLVLLAMHQEWQSIAREEVIRVLGPNGLPTPDILQDLKTLGMIINETLRLYPPAMTLNRDTLRKAKLGSLEIP
AGTQLYLSVVAMHHDRDAWGDDAEEFNPGRFEDTRKESALLVPFGLGVRTCVGQNLAVVEAKTVLATILKHYSFRLSPSY
VHAPVLFVTLQPQKGAHLLFSRI*

DNA
ATGGCAGTGCCCTTCGTCTTCTTCCTCTTTCTCTTCCTTCTCATCTTCAGATTCGTTTACACTAATCTATGGATCCCATG
GAGACTCCAATCTCATTTCAACAAGCTGCACTTAACGGGGCCTCGTTACCGTTTATTCACCGGAAACTCCTCGGAAGTTA
CCCGTTTAACAACCGAAGCGAAGTCAAAGCCGATACCGTCCGGCGACAACCCTCACGAGTTCGTACACCGCGTGGCGCCT
CACTACCACAAGTGGTCACGCGCCTACGGGAAGACTTTCCTCTACTGGTTCGGTACCAAACCGGTGGTTGCCACGTCGGA
TCCGAAACTAATCCGGGAAGCTTTGAAGAGCAAGTCGTTTGATCGTATCGGACACAACCCTTTGTCTAAGCTTCTTTACG
CTCAGGGTCTTCCTGGTCTTAGAGGTGATCAATGGGCTTTCCATAGAAGAATCGCTGTTCAAGCTTTCACCATGGACAAA
GTCAAGAGGTGGGTGCCGCAAATGGTGGCAAGTACTAAGATGTTTATTGAGAAATGGGAGGAGATAAGAAACGGAGAAGA
GGAGATTGAGCTAGATGTACACAGAGAGGTACACAGTTTGTCTGCACATATGTTATCAAGAACAGCTTTTGGTAACAACG
TAGAAGAAGGGAAACGAATCTTTGCCTTGCAAGAGCGTATGATGCGTCTCTTCTATCTAGTCCGATGGAGCATTTACATC
CCTGGGTACAGATTCTTGCCTTCCAAGACTAATAGAGAGATATGGAGGATTGAGAAACAAATCCGTGGTTCTATCCTGGG
ACTCATCGAGAAAAACAAAACAAGAGACGCGGAGATAGCTGGAACTCTGCTTCAGGCTTTTATGTCTCCTTACGTGAATC
ATAATGGTCAAGAGGAGAGGCTTGGGATTGAAGAAGTTATAGATGAATGCAAGACTTTCTACTTTGCAGCTAAGGAAACA
ACTGGTGATCTCATGACTTGGGTGTTAGTCCTCTTAGCTATGCATCAAGAATGGCAAAGCATTGCTCGAGAAGAAGTTAT
ACGCGTCCTTGGACCTAACGGGCTTCCCACTCCAGACATCTTACAAGACCTCAAGACTTTAGGTATGATAATCAATGAGA
CACTCAGGCTCTACCCTCCAGCGATGACGCTAAACCGCGACACACTCAGGAAAGCTAAGCTCGGAAGCCTCGAGATTCCT
GCAGGAACTCAACTGTACTTATCGGTTGTCGCGATGCACCACGACAGAGACGCATGGGGAGATGACGCGGAGGAGTTTAA
CCCGGGTAGGTTTGAAGACACCAGGAAAGAATCGGCTCTGCTTGTGCCGTTTGGGTTAGGGGTGAGGACTTGCGTGGGAC
AGAATCTAGCAGTTGTTGAGGCCAAAACGGTTCTTGCAACGATCTTGAAGCATTACAGTTTCAGGTTGTCTCCAAGTTAT
GTCCATGCTCCTGTTTTGTTTGTGACCTTGCAGCCTCAAAAAGGTGCTCATCTTCTCTTTAGTAGGATTTAA