Details for Chinese cabbage Locus Brara.G03327

Position : A07 ( 5`- 25315296 .. 25318612 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03327

Protein [Map View]
MQTLPNSPPLLRHPAGDDDVDIDFRDVFGGPPKRRSKVIETTGRHSFSEIRRRDVIVDNSALILRDEKPVFGEDPSSIRR
RFTADDFFDDIFRVNESSSSSSPQRKVKNEGETFGSSLPGSRILSPARPIPHKVESPPGTSFPAQFSLPAKLIKGTEMPT
FGSAARSLSRNKEAASSSPLSRTSSSADMVNSTAKPDSDGYVAPKVVNGKVRQFHFSIYKWPNKGVPVAMWGTSRLSSMA
KAEETTPSDLRPTSFEAEGQSSQKRPGVQKEEEMSEQAFSSNVSKAPDEANVKPQHSFLDVKDERQGEEIELEKEERKGK
SKAKSMRSHAGDSRSKKKAQGSRSSVDSPMPDNTSSYASASSAPEVGKDGAKGKVMDFVKIFSQGASAGAGGEPLGQSSR
WRAKEVPVTDTNKDDAKAKETAKVPDQQKTSTPVTPAMDQDQKPSQATQKKVADSSKPSGVTEQEEKQEPSTAHVTSEDI
DEPFHVNFLVEDITQDENKMEETKNNAEEFQNIDAKIRKWSSGKSGNIRSLLSTLQYILWPGCGWKAVPLMDMIEGNAVR
KSYQRALLILHPDKLQQKGASANQKYMAEKVFELLQEAWDHFNTLGPV*

DNA
ATGCAGACACTACCAAACTCACCGCCTCTCCTGCGTCATCCCGCCGGGGACGATGACGTGGACATAGACTTCAGGGATGT
GTTTGGTGGTCCGCCTAAAAGACGGTCCAAAGTTATTGAAACCACCGGTAGACATAGCTTCAGTGAAATCAGGCGGCGTG
ACGTCATCGTCGACAACAGCGCGCTGATTCTCCGAGACGAGAAGCCTGTGTTCGGTGAAGACCCGTCATCCATCCGTCGT
CGTTTCACTGCTGATGATTTCTTCGACGATATCTTCAGAGTGAATGAATCATCATCATCTTCTTCACCGCAGAGGAAGGT
AAAGAACGAAGGAGAAACGTTCGGGTCATCACTTCCGGGTTCTCGGATCCTTAGCCCGGCTCGTCCTATCCCTCACAAAG
TCGAGTCTCCTCCTGGGACTTCGTTTCCTGCACAGTTCAGTCTTCCTGCAAAACTAATCAAAGGGACAGAGATGCCTACG
TTTGGTTCAGCTGCTCGGAGTTTAAGCAGGAACAAGGAAGCTGCTTCGAGCTCTCCTTTGTCAAGAACTTCAAGCAGTGC
TGATATGGTGAACTCTACTGCTAAACCGGATTCAGATGGTTATGTTGCTCCAAAGGTTGTTAATGGGAAAGTGAGGCAGT
TTCACTTCTCTATCTACAAGTGGCCTAATAAAGGAGTTCCTGTTGCCATGTGGGGCACTTCTAGGTTGAGCTCTATGGCT
AAAGCTGAAGAGACGACACCTAGTGATTTGCGTCCTACTTCGTTTGAAGCAGAAGGACAAAGCTCACAAAAGCGTCCTGG
TGTTCAGAAAGAAGAGGAGATGTCTGAACAAGCCTTCTCTAGCAATGTGTCGAAAGCTCCTGATGAGGCTAATGTGAAAC
CTCAACATTCATTTTTAGATGTTAAGGACGAGAGACAAGGTGAGGAAATAGAGTTAGAGAAGGAAGAAAGAAAAGGTAAA
AGCAAAGCGAAGAGCATGAGAAGCCATGCAGGAGATTCAAGAAGCAAAAAGAAAGCACAAGGCAGTAGAAGTTCTGTTGA
TAGCCCCATGCCTGATAATACATCCAGCTACGCAAGTGCATCCTCAGCACCAGAGGTTGGCAAAGATGGAGCCAAAGGGA
AAGTGATGGACTTTGTTAAGATTTTCAGTCAAGGAGCTTCAGCTGGAGCAGGTGGAGAACCTCTTGGGCAAAGCTCTAGA
TGGAGAGCTAAAGAAGTTCCCGTGACTGATACCAATAAAGACGATGCTAAGGCCAAAGAAACTGCAAAGGTTCCTGATCA
ACAAAAGACATCAACTCCAGTTACACCCGCCATGGATCAGGATCAGAAACCTTCACAGGCAACTCAGAAAAAGGTAGCAG
ATAGTAGTAAGCCTAGTGGTGTTACTGAACAAGAGGAGAAACAGGAACCTAGCACAGCACATGTTACCTCAGAGGATATA
GACGAGCCCTTCCATGTAAATTTCCTGGTGGAGGATATAACACAAGATGAGAACAAAATGGAAGAAACAAAAAATAATGC
TGAAGAATTCCAGAACATCGATGCTAAAATACGCAAGTGGTCAAGTGGAAAGAGTGGAAACATTAGGTCTCTCCTGTCTA
CACTGCAATATATTCTATGGCCCGGGTGTGGATGGAAGGCTGTTCCTCTCATGGATATGATCGAAGGAAACGCAGTTCGA
AAATCATACCAGAGAGCATTACTAATCCTTCATCCAGATAAGTTGCAACAGAAGGGTGCTTCTGCAAACCAGAAATACAT
GGCTGAGAAAGTTTTCGAGTTGTTACAGGAAGCATGGGACCATTTCAACACTCTCGGACCGGTTTAA