Details for Chinese cabbage Locus Brara.G03325

Position : A07 ( 5`- 25310844 .. 25312482 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03325

Protein [Map View]
MTSDGATSTSAAAAAAAARRKPSWRERENNRRRERRRRAIAAKIYTGLRSQGDYNLPKHCDNNEVLKALCAEAGWVVEED
GTTYRKGCSRPLPGESPIPSYQVSPSSSRGEPNNSSTTFFPFLRNGAVPSLRISNSCPVTPPLSSPSSKNAKPLPTWDSI
AKQSMVNANKKQSMASFNYPFYAVSAPTSPTRRQFYAPVTIPECDESDSSTVDSGHWISFQKFAQPQQKLPFSGSMVPTS
PTFNLVKPPVPQQMSPNAAFQGMIGQSSEFKFESSQVKPWEGERIHDVGMEDLELTLGNGKARG*

DNA
ATGACGTCGGATGGTGCTACATCCACATCAGCAGCAGCTGCCGCCGCAGCAGCGAGGAGGAAACCGTCGTGGAGGGAGAG
GGAGAACAACCGGAGGAGAGAGAGAAGGAGAAGAGCCATAGCAGCCAAGATATACACAGGTCTAAGATCACAAGGCGATT
ACAATCTCCCCAAACATTGCGATAACAATGAAGTCCTCAAGGCTCTCTGTGCTGAAGCTGGTTGGGTCGTTGAAGAAGAC
GGCACCACTTATCGCAAGGGATGCAGCAGGCCTCTACCTGGTGAGAGTCCCATCCCTTCTTACCAAGTCAGCCCATCTTC
ATCCCGTGGTGAGCCCAACAACAGCTCCACCACCTTCTTCCCCTTCCTCAGAAACGGCGCCGTTCCATCCCTCAGAATCT
CAAACAGCTGTCCCGTTACTCCACCCCTCTCGTCTCCATCTTCCAAGAACGCTAAACCCTTACCTACATGGGACTCTATC
GCTAAGCAGTCCATGGTCAACGCTAATAAAAAACAATCAATGGCGTCCTTTAACTATCCTTTCTATGCGGTTTCTGCACC
TACTAGTCCCACCCGTCGTCAGTTTTATGCTCCGGTTACAATACCTGAGTGTGATGAGTCTGATTCTTCCACTGTTGACT
CTGGTCATTGGATAAGCTTTCAGAAGTTTGCTCAACCTCAACAGAAGCTGCCATTCTCTGGCTCTATGGTGCCGACTTCT
CCTACGTTTAATCTTGTGAAACCTCCTGTGCCTCAGCAGATGTCTCCAAACGCTGCGTTTCAAGGGATGATTGGTCAGAG
CTCTGAGTTTAAATTTGAGAGTAGCCAAGTTAAGCCGTGGGAAGGAGAGAGGATACATGATGTTGGTATGGAGGATCTTG
AGCTTACTCTTGGAAACGGCAAGGCTCGTGGTTGA