Details for Chinese cabbage Locus Brara.G03322

Position : A07 ( 5`- 25303007 .. 25303841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03322

Protein [Map View]
MAGTHILFLVFITSSNDKNNCFLLSCIAVTATVFVLENSCPFTVWPGTLSINSTTLGDGGVPLTPGASVQLTAPPGWSGR
FWARTGCSFDASGRVSCGGVLNCNRGGFPPATLAEFTVGSGVSDMDFYGVSLVDGFNVKMGIDPLGGTGDCHYAGCLADV
NEICPGDLRIMDPNIDGVVVACMSACAAFDSPEFCCTGAHATPQTCDPSRYSTVFKNACPSAYSYAYDDTTSIFTCSRSN
YLITFCPTRS*

DNA
ATGGCGGGTACTCACATTCTCTTCCTTGTGTTCATCACAAGCAGTAACGACAAAAACAACTGTTTTCTATTATCCTGCAT
TGCCGTTACCGCCACCGTCTTCGTCTTGGAGAACAGCTGCCCATTCACCGTCTGGCCAGGAACTCTCTCCATCAACAGCA
CCACCCTCGGCGACGGCGGGGTTCCCCTGACTCCTGGCGCTTCCGTACAGCTCACTGCTCCTCCGGGATGGTCAGGACGC
TTCTGGGCTCGCACCGGCTGCAGCTTCGACGCCTCCGGTCGCGTTAGCTGCGGCGGCGTTTTAAACTGTAACCGCGGGGG
ATTTCCTCCGGCCACTCTAGCCGAGTTCACCGTCGGATCAGGCGTTTCAGACATGGATTTTTACGGCGTTAGCCTCGTCG
ACGGTTTCAACGTCAAGATGGGGATCGATCCCCTGGGAGGAACCGGAGATTGCCACTACGCAGGCTGCCTCGCCGACGTC
AACGAGATTTGCCCTGGAGATCTTCGGATCATGGATCCGAACATCGATGGAGTTGTTGTGGCGTGCATGAGCGCGTGCGC
TGCGTTTGATTCGCCGGAGTTTTGCTGCACCGGTGCTCACGCGACGCCGCAGACTTGTGATCCGAGTCGGTACTCGACGG
TGTTCAAGAACGCTTGCCCTAGCGCTTACAGCTACGCTTATGATGATACGACAAGCATCTTCACTTGTTCCCGATCTAAC
TACTTGATTACTTTCTGCCCCACCCGCTCTTAA