Details for Chinese cabbage Locus Brara.G03320

Position : A07 ( 5`- 25293010 .. 25297328 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03320

Protein [Map View]
MTISVKLPVFSTLLRAPLFAHPLPLLPSSALSFSSAAAATTRLNCTARKARRRICCVMCLARDSASAEHGAEFIEVLVIG
SRKESIMDSCLDSPFPSLPLRFWSISRDSSGDPVLQQRLHHQDNGFKSMNPIELIQSPPKAFILVASAGYGSDLVEAINI
LSAVRSGGSLAVAVLLRPFSFEGRRRLEEVNELAKKLQQHTNFCIDIDIEILLQKDLVTLDEALRNANNAVSKAVNAASA
LISGMHGNFIDVMHKDLKELEGSEVTTILESYKEAKVGFGAGHNLKTSILQAIYDCPFFRPGVKDLKAIICIVASSVALQ
KKDVKTILRTFRQTMEYTGDIIVSTVHEPDLEPKVLVTTFFIQSSEEESSSKGNIFSGVLPFVLNIFKKYRSQLQKETSI
GLGEAPVAMEDSADSSTVKISNQSVEGFEIDSEEVLEVSESGDSEYLVREEEPSRNSRLALGDENIEDYGAIQREPIANW
SVDPGYQIEQKRPADSGDTAVLSLGIVNLPVGVRPSKNSNSSLNVTSQPSRKAGSRDESFFNSNSSRKGSSDDTASTLLS
EKYADFTKQRNLSARAASMLEAERDSSKRWSPIQEMQYRGGLFKGRCQGGLPEGKGRLVLGDGSIYDGMWHNGKRSGLGT
FYFKNGDVFQGTWREDLIHGKGWFYFHKGDRWFANFWKGKASGEGRFYSKSGEIFFGQFKDGWRDGHFLCIDVDGTRYSE
TWDDGVLISRKQMDAGD*

DNA
ATGACGATTTCAGTGAAGCTTCCCGTCTTCTCCACTCTCCTCCGAGCACCATTGTTCGCTCATCCTCTACCTCTCCTTCC
TTCTTCCGCCCTTTCATTTTCATCCGCTGCTGCTGCTACAACGCGATTGAATTGCACCGCTCGAAAGGCGCGTCGAAGGA
TTTGCTGCGTGATGTGCTTGGCGAGAGATTCGGCTTCTGCGGAACACGGAGCTGAGTTCATTGAGGTCCTTGTCATCGGT
AGTCGCAAGGAGTCTATCATGGACTCTTGCTTGGATTCTCCTTTTCCTTCTCTTCCTCTCCGCTTCTGGAGTATTAGCAG
AGACAGCTCTGGAGATCCAGTCTTGCAGCAGAGGCTCCATCACCAAGATAATGGTTTCAAGAGCATGAATCCAATTGAGC
TTATACAGTCACCTCCAAAGGCCTTCATCCTTGTGGCTAGTGCCGGATATGGTTCTGACCTGGTTGAAGCTATTAATATT
CTTAGTGCAGTAAGATCTGGGGGTAGTTTAGCTGTTGCTGTGCTATTAAGACCTTTCAGCTTTGAAGGTCGAAGGCGTCT
TGAAGAGGTTAACGAACTGGCTAAAAAACTGCAGCAACACACAAATTTTTGTATAGATATCGACATTGAGATTTTACTAC
AGAAGGATTTGGTGACTTTGGACGAGGCGCTAAGAAATGCAAACAATGCTGTCTCGAAGGCAGTAAATGCAGCATCTGCT
CTGATAAGCGGGATGCATGGAAACTTTATCGACGTGATGCATAAAGATCTTAAAGAACTTGAAGGCTCAGAAGTCACAAC
GATTCTAGAAAGCTACAAAGAGGCAAAGGTTGGTTTTGGAGCGGGTCACAACCTTAAGACTTCTATTTTACAAGCTATAT
ACGACTGCCCTTTCTTTCGCCCTGGTGTAAAGGATCTAAAGGCCATTATATGCATCGTGGCTAGCTCGGTAGCGCTTCAG
AAGAAGGACGTGAAAACAATTCTCCGCACTTTTCGCCAAACAATGGAGTACACTGGAGACATCATTGTATCCACTGTTCA
TGAACCTGATCTGGAGCCTAAAGTCCTCGTCACAACTTTTTTTATCCAAAGTTCTGAAGAGGAATCTTCCAGCAAAGGCA
ACATTTTTTCTGGTGTTTTGCCTTTTGTTTTGAATATCTTCAAGAAGTATCGTTCACAACTCCAGAAAGAAACAAGTATT
GGACTTGGAGAAGCCCCGGTTGCAATGGAAGATTCAGCAGACTCTTCTACCGTGAAAATATCTAATCAGAGTGTTGAAGG
ATTTGAAATTGATTCTGAGGAAGTCCTGGAAGTTTCTGAGAGTGGTGATAGTGAATACCTAGTAAGAGAGGAGGAGCCAT
CTAGAAACAGTCGCCTGGCTCTTGGAGATGAAAATATAGAAGATTATGGTGCTATCCAGAGGGAACCAATTGCTAATTGG
AGTGTGGATCCGGGGTATCAGATTGAGCAGAAACGGCCAGCTGATTCTGGAGACACCGCAGTGCTTAGCCTGGGTATTGT
CAACCTTCCTGTTGGTGTGAGACCTTCAAAGAATTCGAACAGTAGTCTCAATGTCACTAGTCAACCCTCTAGAAAGGCTG
GTTCCAGAGATGAATCATTTTTCAACTCTAATAGCTCGAGAAAAGGCTCTAGTGATGATACTGCATCTACCTTGCTATCT
GAGAAATATGCTGACTTTACAAAGCAAAGGAACTTATCCGCTCGAGCAGCGTCTATGCTGGAAGCTGAGCGGGATTCATC
AAAAAGATGGAGTCCTATTCAAGAGATGCAGTACAGAGGAGGATTGTTCAAGGGAAGATGCCAAGGAGGCCTTCCCGAAG
GAAAGGGTCGTTTGGTACTTGGAGATGGAAGCATATATGATGGGATGTGGCACAACGGTAAAAGATCTGGTCTTGGAACG
TTCTACTTCAAGAATGGTGACGTGTTCCAAGGCACTTGGAGAGAAGATTTAATACACGGAAAGGGCTGGTTCTATTTCCA
CAAAGGTGACCGGTGGTTTGCAAATTTCTGGAAAGGAAAAGCGAGCGGGGAAGGACGGTTCTATTCAAAGTCAGGTGAGA
TATTCTTTGGACAATTTAAAGATGGATGGCGTGACGGACACTTCCTCTGTATAGACGTGGATGGAACAAGATACTCTGAA
ACTTGGGACGACGGTGTTCTTATTAGCCGGAAACAAATGGACGCCGGAGATTGA