Details for Chinese cabbage Locus Brara.G03315

Position : A07 ( 5`- 25274805 .. 25276357 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03315

Protein [Map View]
MSSSAECWEFSGERKRLLEKKPSFSQTCSRLSRYLKEKGSFGDLSLGMTCNGGLAVTRQQPTMMNLFPVEDSSDVKQKND
VIPRQLSFSSSSSSGAKEEVEKITETKSVKVESQSSVPLTIFYGGQVMVFDDFPAEKAKQVIDLAHKGSAKSFTAELNRN
QSAYTQKEIASTTPVPVPSPVKTTAPEPTQTNKSSLACELPIARRASLHRFLEKRKDRISSKAPYQIDGSTEASSKPNTA
LLGSQ*

DNA
ATGTCGAGTTCTGCCGAGTGTTGGGAGTTTTCCGGCGAGAGGAAGAGGTTGCTCGAGAAGAAGCCGAGCTTCTCGCAGAC
ATGTAGTCGATTGAGTCGGTATCTCAAGGAGAAGGGTAGCTTCGGAGATCTGAGCTTAGGGATGACTTGCAATGGAGGTT
TGGCTGTGACACGTCAGCAGCCGACGATGATGAATCTCTTCCCTGTTGAAGATTCTTCAGACGTTAAACAGAAGAACGAT
GTGATTCCTCGGCAATTAAGCTTCTCTTCTTCCTCGTCCTCTGGAGCCAAGGAAGAAGTGGAGAAGATCACAGAAACTAA
ATCAGTGAAGGTGGAGTCTCAATCTTCTGTTCCGTTGACTATATTCTACGGTGGTCAAGTTATGGTGTTTGATGATTTTC
CTGCTGAGAAAGCCAAGCAAGTCATTGACTTGGCTCACAAGGGAAGTGCTAAAAGCTTCACAGCTGAGCTGAACCGTAAC
CAGAGTGCTTATACTCAAAAAGAGATTGCTTCCACTACTCCAGTTCCAGTTCCTAGTCCTGTGAAAACAACAGCACCAGA
GCCAACCCAGACCAACAAGTCCTCTTTAGCTTGCGAACTCCCAATTGCTAGAAGAGCTTCACTTCATCGATTCCTTGAGA
AGAGAAAGGATAGGATTTCATCAAAGGCACCGTACCAGATAGATGGTTCAACCGAAGCATCTTCCAAGCCTAACACAGCT
TTGCTCGGTTCCCAGTAA