Details for Chinese cabbage Locus Brara.G03311

Position : A07 ( 5`- 25260625 .. 25263633 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03311

Protein [Map View]
MVSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQIYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLNCDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPDIFTAIRDVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETIDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVTGDVFIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGTGAGCTCGATGGATGAGAAAGTGGTGGCTGTGATCATGGTCGGTGGTCCAACCAAAGGTACTCGATTCCGACCATT
GTCCCTGAATATTCCAAAGCCTCTGTTTCCTATTGCGGGACAACCAATGGTGCATCATCCAATTTCAGCGTGTAAAAGGA
TTCCAAACTTAGCTCAAATCTATCTTGTTGGTTTCTATGAGGAAAGGGAGTTTGCCCTTTATGTCTCTGCCATTTCCAAT
GAACTCAAAGTTCCTGTCAGATATCTGAGAGAAGACAAGCCACATGGTTCAGCTGGTGGTCTGTATCACTTTAGAAATCT
AATCATGGAAGATGACCCGTCTCATATCTTCCTGCTTAACTGTGATGTTTGCTGCAGTTTCCCCTTGCCTGAAATGCTCG
AGGCTCATCGGAAATATGGTGGAATTGGAACACTTCTTGTGATCAAGGTCTCTCCTGAATCAGCCAGCCAGTTTGGAGAA
CTGGTTGCAGATCCAGTTACTAATGAGCTGCTTCATTACACCGAGAAACCTGAAACTTTTGTCAGTGACCGTATTAACTG
CGGTGTTTATGTATTTACACCTGACATTTTTACTGCCATAAGAGATGTTTCTTCTCAAACGAAAGATACAGCAACTTTGA
GACGTGTTTCCAGCGTTGAAGCTCTTCAACCGGCAACAAGGAACTCCACGGATTTTGTAAGACTGGATCAAGACATCCTT
TCACCTCTAGCTGGGAAGAAACAGCTATATACTTACGAGACTATAGATTTCTGGGAGCAAATTAAATCTCCTGGAATGTC
GCTGAGGTGCTCGGAACTCTATCTTTCTCAGTTCCGGTTGACCTCACCCCAAGTGCTGGCTAGTGGAGATGGAACAAAGA
GTGCCATAGTGACTGGTGATGTTTTCATACATCCTTCTGCAAAAGTACACCCAACTGCAAAGATTGGTCCCAACGTCTCA
ATCTCTGCCAATGCTCGTGTTGGACCCGGTGTCAGGCTTATCAGCTGTATCATCCTTGATGACGTTGAGATCATGGAAAA
TGCAGTGGTGACTAACGCAATTGTTGGGTGGAAATCTTCTATCGGGAGATGGTCCCGTGTCCAGGCTGAGGGAGTCTACA
ACTCCAAACTCGGAGTTACAATTCTCGGAGACTCGGTTGCAGTTGAAGACGAGGTTGTGGTGACCAGCAGTATCGTTCTT
CCAAACAAGACACTCAACGTCAGTGTTCAAGACGAGATCATCTTGTAA