Details for Chinese cabbage Locus Brara.G03309

Position : A07 ( 5`- 25256183 .. 25257655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03309

Protein [Map View]
MALGDLSSSSSTSELHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGLDGDKGSSGLKDLKVNLIVTDYSMP
GLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMTEGAEDFLLKPVKLADVKRLKELIMRGGEAEQEKTSNLISPK
RILQNNIFFFIIFFIITITIIFIV*

DNA
ATGGCACTAGGAGATTTATCTTCTTCTTCTTCTACCTCGGAGTTACATGTTCTCGCTGTGGATGATAGTATTGTTGATCG
TAAGGTTATTGAGAGGTTGCTTAGGATCTCTGCTTGTAAAGTGACGACTGTTGAGAGTGGGACTAGGGCTCTTCAGTATC
TTGGTCTAGATGGAGACAAAGGATCTTCTGGTCTTAAGGATTTGAAGGTGAACTTGATAGTGACAGATTACTCTATGCCG
GGACTAACAGGATATGAACTACTCAAGAAGATCAAAGAGTCTTCAGCATTCAGAGAAATACCTGTAGTGATAATGTCGTC
TGAGAACATACAACCTCGTATAGAACAATGCATGACAGAAGGAGCAGAGGATTTTCTGCTAAAACCGGTGAAATTAGCAG
ATGTGAAGCGGCTTAAAGAACTCATAATGAGAGGTGGTGAAGCTGAACAAGAGAAAACCAGTAACCTTATTAGTCCTAAG
AGAATCCTTCAAAACAACATCTTCTTCTTCATCATCTTCTTTATTATCACTATCACTATCATCTTCATCGTCTAA