Details for Chinese cabbage Locus Brara.G03306

Position : A07 ( 5`- 25249245 .. 25252599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03306

Protein [Map View]
MMLAGLHLVRLKFGWINLSLNKLNKRETKKKRTNLFRLSFFLARVFDLGRKTKKSHNRFSATALSAPMGDSETLAALKRA
YADTILNTTKEAAARVLSSEKKTRMYQQEIVTVKDEAITTLLRLKQMYDSKVKETEEMSLKQQQKVEELEAQLGEAEDIV
GELRMELRALHDELNKVTNGNTSYLKGDHQEVSCRKASDAAVSSSQERSGAVPVEQSGSVVANGITNQSLARINSIKRCS
SKDSMDRCHHTLPSILTKRREVEGCTQMIHAVDKKSMVNGDGKDPMVSQNTSPKEHEQNRRTVISATEARKEEKGILASP
LCEETPVLAASKNRCIKYTFKRKRKKEASSNLEGDSSFEESRNVKQKTGEKDDGYLESLKPSFTGESSRDSLCVAQMARQ
LVPFSKKTSFAAELVNQ*

DNA
ATGATGCTTGCCGGTTTACATTTGGTTAGATTGAAATTCGGTTGGATAAATTTATCGCTTAATAAATTAAATAAAAGAGA
AACAAAAAAAAAAAGAACCAACCTTTTTCGCCTTTCTTTCTTCTTGGCGAGAGTCTTCGACCTTGGTCGGAAAACAAAAA
AATCTCATAATCGCTTCTCCGCAACCGCATTATCGGCTCCAATGGGCGACTCCGAGACCTTAGCGGCGTTGAAGAGAGCC
TACGCGGATACGATACTCAACACGACGAAGGAGGCGGCGGCGCGTGTGTTGTCTTCTGAGAAGAAGACGCGTATGTATCA
GCAAGAGATTGTGACGGTTAAAGACGAAGCTATCACTACGTTGCTTAGGCTTAAACAGATGTATGATTCAAAGGTGAAGG
AGACAGAAGAGATGTCCTTGAAGCAGCAACAAAAGGTTGAGGAACTTGAAGCTCAGCTTGGAGAAGCTGAAGATATTGTA
GGGGAGCTGAGGATGGAACTTCGAGCACTTCATGATGAGCTCAACAAAGTTACCAATGGTAACACATCATATCTTAAAGG
TGATCACCAGGAAGTCTCTTGTCGAAAAGCAAGTGATGCAGCAGTTTCTAGCAGTCAGGAGCGATCAGGAGCTGTCCCAG
TTGAACAAAGTGGATCGGTGGTGGCTAACGGGATCACAAACCAATCTTTGGCTCGCATAAATAGTATCAAACGGTGTTCT
TCTAAAGATAGCATGGATCGTTGTCACCACACTCTTCCGTCTATATTGACAAAGCGCAGGGAGGTTGAAGGATGTACACA
GATGATTCACGCAGTAGATAAGAAGAGTATGGTCAATGGAGATGGAAAAGACCCAATGGTGTCTCAAAACACATCTCCGA
AGGAACATGAACAGAACAGAAGGACTGTGATTAGCGCAACAGAGGCAAGGAAGGAAGAAAAAGGGATTTTGGCATCTCCT
TTGTGTGAAGAAACTCCAGTTTTGGCTGCTAGTAAGAACCGATGTATCAAGTACACATTCAAGAGGAAGAGAAAGAAGGA
GGCTTCAAGCAATCTTGAAGGAGATTCATCCTTTGAGGAGAGCAGAAACGTGAAACAGAAGACTGGGGAGAAAGACGATG
GTTATCTGGAATCTCTGAAGCCTAGCTTCACCGGTGAATCATCTAGGGATAGTCTCTGCGTAGCACAGATGGCTCGGCAG
CTTGTACCATTCTCGAAGAAGACTAGTTTTGCAGCAGAACTAGTCAACCAGTAG