Details for Chinese cabbage Locus Brara.G03304

Position : A07 ( 5`- 25243210 .. 25244557 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03304

Protein [Map View]
MADGSSCSSDSGCISREIMLFGVRVVLDPMRKSVSLNNLSEYEQTEEIPKIIIAEDEKNKTSSGYASADDAVPISSSRER
KRGVPWTEEEHKLFLLGLKKVGKGDWKGISKNFVKTRTSTQVASHAQKYFLRRSNLNRRRRRSSLFDMTTDTVMPMEKDQ
MLMHENMSQPSSLVPEIKIHPVMQIFPEFPVPTSGGNASRNHLVPFTFQARPEPISLSLTLASSNLNDPSSSRHSAFNTI
GVA*

DNA
ATGGCGGATGGTAGTAGTTGTTCGTCGGATTCAGGCTGCATCAGTAGAGAGATCATGCTGTTTGGTGTCCGGGTGGTTCT
TGATCCGATGAGAAAGAGTGTGAGTTTGAACAACTTGTCTGAGTACGAGCAGACGGAGGAGATCCCAAAGATCATCATCG
CCGAGGATGAAAAGAACAAAACCTCCTCCGGTTACGCCTCCGCGGACGACGCTGTTCCGATCTCTTCTAGCCGAGAGAGG
AAACGAGGAGTTCCATGGACAGAGGAAGAGCACAAGCTGTTCTTGCTTGGGCTGAAGAAAGTAGGGAAAGGAGATTGGAA
AGGAATATCTAAGAACTTTGTCAAGACCAGGACGTCTACTCAAGTAGCTAGTCACGCTCAGAAATACTTCCTCCGGCGAA
GTAATCTCAACCGTCGCCGGCGAAGATCTAGTCTTTTCGACATGACAACTGACACGGTCATGCCCATGGAAAAAGATCAG
ATGCTTATGCATGAGAACATGTCACAACCATCTTCTCTTGTACCTGAAATCAAGATACACCCGGTTATGCAAATCTTTCC
TGAGTTTCCGGTACCAACATCTGGTGGTAATGCATCAAGGAACCATCTGGTACCATTTACTTTTCAAGCACGGCCTGAAC
CAATCTCTCTCAGCCTCACACTAGCCTCATCTAATCTTAATGACCCGTCTTCCTCAAGGCACTCAGCATTCAACACGATT
GGAGTTGCTTAG