Details for Chinese cabbage Locus Brara.G03303

Position : A07 ( 5`- 25240222 .. 25242066 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03303

Protein [Map View]
MITQLLCFFLFLFLLLQATMIFKRSFKNFVEQELGSFPKFLIYTVLEWILITALFVDGVLAFLSNQYARFFDLDAPCLLC
TRIDHVLVPRDPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTYKSLIGILHKDLEVLI
EDERDLPLGLKKQDDLVQTTTTHLIDYKTDSLKQHCSCCGELLKTKSEKFLKKNNSFLAPAPSPRVSYNKLSEINESEFK
DFDVEERTPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLRKPPSLDKIEIPDSNGESILNQLKKEVRLDKKSLIDLYMELD
EERSASAVAANNAMAMITKLQAEKSAIQMEALQYQRMMDEQAEYDQEALQSMSSDLAKKEEEFKELEAEFEAYRERYGCL
TDDEASGDEFLEEQGNARADDEGAGDEFLEEHGNARADDDCQETKPDSDFEDCSSNQEEDVENVDQNRSCKSEESGLLVQ
MKSSEQSTEVNGASAEEEKGSVSKEGIVKELSEITERLSALQSDGELLKHIADVSEGEAMLLQISQNLHMLRSSFVAMPS
ES*

DNA
ATGATTACACAATTGCTCTGTTTCTTCTTGTTCTTGTTTCTTCTATTACAAGCAACAATGATCTTTAAACGCTCTTTCAA
AAACTTCGTTGAACAAGAACTCGGATCTTTCCCTAAATTCCTCATCTACACCGTCCTCGAATGGATTCTCATCACCGCCC
TCTTCGTCGACGGGGTTCTCGCCTTTCTATCAAACCAATACGCCAGATTCTTCGATCTCGACGCTCCTTGTCTCCTCTGC
ACAAGAATAGACCACGTTCTCGTCCCTAGGGATCCTCATTTCTATTACAACGACTCGATCTGCGACTCTCACAAGAAGAA
AGTCTCTTCCCTTGCTTATTGCCACGTCCACAAGAAACTCTCCGAGATCAAACACATGTGTGAAGGATGTCTCCTCTCTT
TCGCTACCGAGAAAGAATCTGATTGTGATACGTATAAGTCTCTCATTGGGATCTTACATAAAGATCTTGAGGTTCTTATA
GAAGATGAAAGAGATCTTCCCTTGGGGCTCAAGAAACAGGACGATCTTGTTCAGACAACAACAACACATCTGATAGATTA
CAAGACAGATAGCTTGAAACAACATTGTTCGTGTTGTGGAGAATTATTGAAGACGAAATCTGAAAAGTTCTTAAAGAAGA
ACAATTCTTTCCTAGCTCCTGCTCCTTCTCCTAGGGTTTCGTACAACAAGCTGTCTGAAATTAATGAGTCTGAGTTTAAG
GACTTTGATGTGGAGGAGAGAACACCGAGTTTTGTAAGAGGAGGCAACAAGTTCTTTGGGGTTCCTCTGTCTGATTCAGC
GCAAAACAGTCCAAGATGGTCCGTTAGATCTCTCAGGAAACCCCCCTCTTTGGATAAGATTGAGATACCTGATTCAAACG
GTGAATCCATCCTTAATCAGCTCAAGAAAGAGGTTCGTTTGGACAAGAAGTCACTGATAGATCTGTACATGGAGTTAGAT
GAAGAGAGAAGTGCTTCAGCTGTTGCAGCAAACAACGCAATGGCTATGATCACAAAGCTGCAAGCCGAAAAATCGGCTAT
TCAAATGGAGGCATTGCAGTACCAAAGAATGATGGATGAACAAGCTGAGTATGACCAAGAGGCTTTGCAGTCTATGAGTA
GTGACTTGGCGAAGAAGGAAGAGGAATTTAAGGAACTTGAAGCTGAGTTTGAGGCTTATAGAGAGAGGTACGGATGTTTG
ACTGATGATGAAGCCTCGGGAGATGAGTTTCTTGAGGAACAAGGTAACGCTAGGGCAGATGATGAAGGCGCAGGAGATGA
GTTTCTTGAGGAACACGGTAATGCTAGAGCAGATGATGACTGCCAGGAAACCAAACCAGACTCTGACTTTGAAGATTGTT
CTTCAAATCAAGAGGAGGATGTAGAAAACGTTGATCAAAATAGGTCTTGTAAATCCGAAGAATCTGGACTTTTGGTACAA
ATGAAAAGCTCAGAGCAGTCTACTGAAGTGAATGGTGCATCTGCAGAGGAAGAGAAAGGAAGTGTAAGCAAAGAAGGGAT
AGTAAAAGAGCTTTCGGAGATCACAGAGAGGCTAAGTGCGCTTCAGTCAGATGGTGAACTGTTGAAACATATTGCAGATG
TTAGTGAAGGAGAAGCAATGCTATTGCAAATATCTCAGAACTTGCACATGCTTCGTAGTAGTTTTGTTGCTATGCCTTCA
GAATCATGA