Details for Chinese cabbage Locus Brara.G03302

Position : A07 ( 5`- 25235129 .. 25238456 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03302

Protein [Map View]
MKKPKSSKPEKIDKLDLFSSLWKQRSFRVIIAIGLLYLLMVTVEIPLVFKSWSSSNSVSIDSLSRPEKLETEEQDPPQIE
IISNPPPKPDSKPALNREHHRGLLSSLRFDSETFDPSSKDGSVELHKSAKEAWQLGRKLWKELESGRLEKSVEKPENKTD
SCPNSVSLTGSEFMNRENKLMELPCGLTLGSHITLVGRPRKSYPKGGVGDGSMLVSQFVIELQGLKTVDGEDPPRILHFN
PRLKGDWSRRPVIEQNTCYRMQWGSSQRCEGWRSRAEEETVDSHVKCEKWIRDDDNYSEGSRARWWLNRLIGRRKRVKVE
WPFPFVEEKLFVLTLSAGLEGYHINVDGQHVTSFPYRTGFTLEDATGLTVNGDIDVHSVVVASLPTSHPSFAPQRHLELS
KRWQAPLVPDGPVELFIGILSAGNHFGERMAVRKSWMQHVLITSSKVVARFFVALHGRKEVNVELKKEAEYFGDIVLVPY
MDSYDLVVLKTVAICEHGALAYSAKYIMKCDDDTFVKLGAVINEVKKVPEGRSLYIGNMNYYHKPLRGGKWAVTYEEWPE
EDYPPYANGPGYVLSSDIARFIVEEFERHKLRLFKMEDVSVGMWVEHFKNTSNPVDYRHSLRFCQFGCVENYYTAHYQSP
RQMICLWDKLLRQNKPECCNMR*

DNA
ATGAAGAAACCCAAATCGTCAAAACCCGAAAAAATCGACAAGCTCGATCTCTTCTCATCACTATGGAAGCAGAGATCTTT
CCGTGTAATAATAGCAATTGGGCTCCTCTATCTCCTAATGGTCACTGTCGAGATACCCCTCGTGTTCAAATCCTGGTCCT
CCAGCAACTCCGTCTCCATCGATTCTCTCTCCAGACCCGAGAAGCTCGAAACAGAAGAGCAAGACCCGCCCCAAATCGAG
ATCATCTCTAATCCACCTCCTAAACCGGATTCTAAACCGGCCCTTAACCGTGAACACCACAGAGGTCTCCTCTCGAGCCT
TAGATTCGACTCGGAAACGTTCGACCCGAGTAGCAAAGACGGGTCAGTGGAGCTTCACAAGTCAGCCAAGGAGGCGTGGC
AGCTAGGGAGGAAGCTCTGGAAGGAGCTCGAGTCAGGGAGGCTTGAGAAGTCGGTGGAGAAGCCCGAGAATAAGACAGAT
TCTTGTCCAAACTCTGTTTCGTTAACCGGGTCTGAGTTTATGAACCGGGAGAATAAGCTGATGGAGCTTCCCTGTGGGTT
GACGTTGGGCTCGCATATCACTTTGGTTGGGAGGCCGAGGAAGAGTTATCCTAAAGGAGGAGTTGGAGACGGGTCTATGT
TGGTTTCTCAGTTTGTGATTGAGCTTCAGGGTTTGAAGACTGTTGATGGAGAGGATCCTCCTCGGATCTTGCATTTTAAC
CCGAGGCTTAAGGGGGATTGGAGTAGAAGGCCGGTGATTGAGCAGAACACTTGTTATAGGATGCAGTGGGGGTCTTCGCA
ACGGTGTGAAGGGTGGAGGTCGAGAGCTGAGGAAGAGACTGTTGATAGTCATGTGAAGTGTGAGAAGTGGATCCGTGATG
ATGATAACTACTCAGAAGGGTCGAGGGCGAGATGGTGGTTGAACAGACTCATAGGAAGGAGGAAAAGGGTCAAAGTTGAA
TGGCCGTTTCCTTTTGTGGAAGAGAAGCTCTTTGTTCTCACTCTTAGCGCTGGTTTAGAAGGTTACCATATCAATGTTGA
TGGACAGCATGTTACATCTTTCCCTTACCGCACCGGTTTCACGCTGGAGGATGCAACGGGACTAACTGTGAACGGAGACA
TTGATGTCCACTCTGTGGTTGTTGCCTCTCTGCCAACATCACACCCCAGTTTCGCTCCCCAAAGGCATCTCGAGTTGTCG
AAAAGATGGCAGGCTCCTTTGGTTCCTGATGGGCCTGTGGAGCTTTTTATCGGTATTCTTTCGGCGGGGAATCATTTTGG
AGAACGGATGGCTGTGAGGAAGTCGTGGATGCAGCATGTTCTTATCACATCTTCAAAAGTTGTTGCTCGTTTCTTTGTGG
CACTCCATGGGAGGAAAGAGGTGAATGTGGAACTGAAGAAAGAAGCAGAGTACTTTGGGGACATTGTGCTTGTTCCTTAC
ATGGATAGCTATGATCTTGTCGTCCTCAAAACTGTTGCCATATGTGAACACGGAGCTCTTGCATACTCTGCAAAGTATAT
AATGAAGTGTGACGATGATACATTTGTGAAACTTGGCGCAGTGATCAATGAAGTGAAGAAAGTACCCGAAGGTAGAAGCT
TGTACATTGGTAACATGAATTATTACCACAAACCTCTCCGTGGGGGTAAATGGGCTGTCACATACGAGGAATGGCCAGAG
GAGGATTATCCACCCTATGCAAATGGACCTGGATATGTTCTGTCTTCTGACATTGCACGCTTCATCGTGGAAGAGTTTGA
GAGACACAAACTACGGCTGTTCAAGATGGAGGACGTAAGTGTAGGAATGTGGGTGGAGCATTTCAAAAACACATCAAACC
CAGTGGACTACAGACACAGTCTTAGATTTTGCCAGTTCGGTTGTGTTGAGAACTACTACACAGCTCATTACCAGTCGCCA
AGACAGATGATATGCTTATGGGACAAGCTCTTAAGACAGAACAAGCCAGAGTGTTGTAACATGAGATGA