Details for Chinese cabbage Locus Brara.G02875

Position : A07 ( 5`- 23039457 .. 23040697 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G02875

Protein [Map View]
MFLLRSQKLWTVVLILVISSRVTHSLHFDLHSGRTKCIAEDIKSNSMTVGKYSVDNPHEGHDLPQSHKISVKVTSSSGNA
YHHADQVASGQFAFSAVEAGDYMACFSAVDHKPEVTLSIDFEWRTGVQSKSWATVAKKSQVETMEFDVKSLLDTVNSIHE
EMFYLREREEEMQDLNRSTNTKMAWLSLLSLFVCIGVAAMQYVHLKTFFEKKKVI*

DNA
ATGTTTCTTCTCCGGTCGCAGAAGCTATGGACGGTGGTTCTGATTCTAGTGATTTCGTCGCGTGTAACGCACTCGCTGCA
CTTCGATCTGCACTCGGGACGGACGAAGTGTATAGCGGAAGACATCAAGAGCAATTCAATGACCGTCGGAAAGTACAGCG
TCGATAACCCTCACGAAGGCCACGATTTGCCTCAATCTCACAAGATCTCCGTCAAGGTAACGTCAAGCTCAGGGAACGCG
TACCATCACGCGGATCAAGTGGCGTCTGGGCAGTTCGCGTTCTCGGCAGTGGAAGCAGGGGACTACATGGCGTGTTTCTC
AGCCGTTGATCATAAGCCTGAGGTGACTCTGAGCATTGATTTTGAGTGGAGGACGGGTGTTCAATCCAAGAGCTGGGCTA
CTGTTGCCAAGAAGAGCCAAGTCGAAACCATGGAGTTTGATGTAAAGAGCCTTCTTGATACTGTCAACTCTATTCATGAA
GAGATGTTTTATCTTAGAGAAAGGGAAGAAGAAATGCAAGATCTGAACCGGTCAACAAACACTAAAATGGCGTGGTTGAG
TTTGCTCTCTTTATTCGTCTGCATAGGAGTGGCAGCTATGCAGTATGTACACTTGAAGACCTTTTTCGAGAAGAAGAAAG
TCATCTAA