Details for Chinese cabbage Locus Brara.G02872

Position : A07 ( 5`- 23026485 .. 23027774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G02872

Protein [Map View]
MSDEEHHFESSDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEDIVPSSHNC
DVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDEALLTQLKSGFEEGKDIVVSVMSAMGEEQMCALKEVSPK*

DNA
ATGTCGGACGAGGAGCATCACTTTGAGTCAAGCGACGCAGGAGCTTCCAAGACCTATCCTCAACAAGCTGGTAACATCCG
TAAGGGTGGTTACATCGTCATCAAAGGCCGTCCCTGCAAGGTGGTTGAGGTTTCGACTTCAAAGACAGGCAAGCACGGTC
ACGCCAAGTGTCACTTTGTAGCCATTGATATCTTCACTTCTAAGAAGCTCGAAGATATTGTTCCTTCTTCCCACAATTGT
GATGTTCCACATGTGAACCGTGTTGACTATCAGTTGATTGATATCTCTGAAGATGGCTTTGTCAGCCTTCTTACTGACAA
TGGTAGCACTAAGGATGATCTCAAGCTCCCAACTGATGAAGCTCTCCTCACACAGCTCAAGTCTGGATTTGAAGAGGGAA
AGGATATAGTTGTGTCTGTCATGTCTGCAATGGGAGAGGAGCAGATGTGTGCCCTGAAGGAAGTTTCTCCCAAGTAA