Details for Chinese cabbage Locus Brara.G02868

Position : A07 ( 5`- 23005116 .. 23010215 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G02868

Protein [Map View]
MVHRESFLSSMKDLSQDSNTCSRSGDNKNVQYNQNGFSMRAPPPEESHFGNERDFLKQTMLQHEAVFKNQVHELHRLYRT
QKSLMDEVKGNNNQSEHTPESAIKRDLPAFLLGKPVCGGEGSSSQACNNVPMANGVSSKDEEEVRPVKVRRRMIDLQLPA
DEYLDDADCPQEAGRGNNASHLNGSSSVMKNQNGLTDLNEPVQCQDGPSSRDVYSLYGKNIVHAQRQWLETNVNQNGWMV
LEAGRGKSIPRENLCVPSQPVQVLANHAFGYPPSTDQRRLLSGEWEARQRNPEVSYDSYVESSVASNAPSLTNGGYRPEP
SRTWSHWISNRSNGSVQKPLPFQTNPLLSYSTQARADSNSEMRRRGGFEGVYQGFSSGLKETAFGVPPSNLNHFNNGPNG
AVTNGSLKHQSFESLQGPKRQECSAALPWLKPNPPNKNGLTNGGFDLNASADGSSNVSPPNGLGRAEMASSLSSGKILGY
PISHKRSIWECNSSFNSPPVSLKEATTLVNRNFDINLPCDASVAEDVESKKAATNRNYIDLNLCASEDESPGLCSKPRVE
TRATPLIDLEAPPALESEDEGERTPEKRDEAGETLDELIKGAAEAIVTISLSHNPDEAASSTTDAAAKDPLSWFVNTIAS
CGGDLEKRLDACLEGCREECSSGEVDYFEAMTLNLPPTKEEDYMPAPLVPEHLKFEGTDSIGINKPRRGQARRGRPRRDF
QRDVLPGLASLSRLEVTEDLQMFEGLMKATGYSWNSGVARRSSNRGGSSRGRKRLISNVNGAPVCSSLEGPVDNSNVQMV
GLEDRSLTGWGNATRRPRRQRCPAGSTPPTVILT*

DNA
ATGGTTCACCGTGAAAGCTTCTTGTCTTCAATGAAGGATCTCAGCCAAGATTCAAACACTTGCAGCCGGTCGGGAGATAA
TAAAAATGTGCAATATAATCAGAATGGTTTCTCGATGAGAGCTCCTCCCCCGGAGGAATCTCACTTTGGAAACGAGAGAG
ATTTTCTTAAGCAAACTATGCTTCAGCACGAAGCCGTTTTCAAGAATCAGGTTCATGAACTTCACCGTTTGTATAGAACG
CAAAAGAGCTTGATGGATGAAGTTAAAGGAAACAACAACCAGTCTGAACACACACCGGAGAGTGCCATCAAACGCGACCT
GCCTGCGTTTCTCTTGGGTAAACCGGTGTGTGGTGGTGAAGGAAGCAGCTCCCAAGCTTGCAACAACGTTCCCATGGCGA
ATGGTGTTAGCTCAAAGGACGAGGAGGAGGTTAGGCCTGTGAAGGTCAGGAGAAGAATGATTGATCTTCAACTCCCCGCG
GATGAGTATCTCGATGATGCAGACTGTCCTCAAGAAGCTGGAAGAGGCAACAATGCTTCTCATCTGAACGGTTCTTCTTC
GGTTATGAAGAACCAAAATGGGCTAACTGATTTGAACGAGCCTGTCCAGTGCCAAGATGGTCCTTCTTCCAGGGATGTAT
ACTCTCTTTATGGCAAAAACATTGTACATGCGCAACGCCAGTGGTTGGAAACGAATGTAAATCAAAATGGATGGATGGTT
CTAGAAGCAGGGCGTGGAAAAAGCATTCCAAGAGAGAACTTATGTGTGCCTTCACAGCCAGTACAAGTTCTTGCTAACCA
TGCATTTGGCTATCCTCCTTCAACTGATCAGAGGAGGTTGTTATCCGGCGAATGGGAAGCTCGTCAAAGGAATCCTGAAG
TTTCCTATGATAGCTATGTGGAATCAAGTGTGGCATCAAATGCTCCAAGCTTGACTAATGGTGGCTACCGCCCTGAACCT
AGCAGAACTTGGAGCCACTGGATTTCAAACCGGAGTAACGGCTCAGTTCAGAAACCTTTGCCGTTTCAAACGAATCCACT
CTTGAGTTATAGTACGCAAGCAAGAGCAGATTCAAACTCTGAGATGAGAAGACGTGGCGGCTTTGAAGGGGTTTACCAAG
GGTTCTCTTCAGGGTTGAAGGAAACTGCCTTTGGTGTACCACCAAGTAACCTTAACCATTTTAACAATGGTCCAAATGGG
GCTGTTACAAATGGTTCTTTGAAGCATCAGAGCTTTGAAAGTCTTCAAGGACCAAAAAGACAGGAATGCTCTGCTGCGTT
GCCCTGGTTAAAACCTAACCCCCCTAACAAAAACGGACTAACCAATGGCGGTTTTGATTTGAATGCTTCTGCTGATGGCT
CGAGTAATGTATCTCCTCCCAACGGTTTGGGACGGGCTGAAATGGCTAGTTCATTGAGTAGTGGAAAGATTCTTGGATAC
CCTATCTCTCATAAGCGTTCTATTTGGGAGTGCAACTCTTCCTTTAACTCTCCCCCTGTGTCTCTCAAGGAAGCAACCAC
TTTGGTGAATAGAAACTTCGACATTAACTTGCCATGTGACGCCTCGGTTGCTGAAGATGTTGAAAGTAAAAAAGCTGCCA
CTAACAGGAACTACATTGACTTGAATCTATGTGCTAGTGAGGATGAAAGTCCCGGCTTGTGTTCCAAACCAAGAGTGGAA
ACAAGAGCAACTCCTTTAATAGATTTGGAAGCTCCCCCGGCTCTCGAGAGTGAAGACGAAGGGGAGAGAACGCCAGAGAA
GAGAGATGAAGCTGGAGAGACTCTTGATGAACTCATCAAGGGAGCAGCAGAAGCTATAGTCACCATCTCACTGTCTCATA
ATCCTGACGAAGCTGCTTCCTCTACGACCGATGCAGCTGCTAAAGACCCGCTCTCTTGGTTTGTGAACACAATTGCTTCT
TGCGGCGGTGATTTAGAAAAGAGGCTTGATGCTTGTTTAGAAGGCTGCCGTGAGGAGTGTTCTTCAGGGGAGGTTGATTA
CTTCGAGGCAATGACTCTGAACTTACCACCAACAAAAGAAGAAGACTACATGCCAGCGCCTCTAGTCCCTGAACATCTGA
AATTCGAGGGGACGGATTCTATAGGCATCAACAAGCCAAGGAGAGGACAAGCAAGACGAGGAAGACCAAGAAGGGATTTC
CAAAGGGATGTTCTCCCTGGACTTGCTTCTCTGTCTAGGCTCGAAGTAACAGAAGATCTTCAAATGTTTGAGGGACTTAT
GAAAGCCACAGGCTACAGCTGGAACTCAGGAGTGGCTAGAAGAAGCTCAAACCGAGGTGGGTCTAGCCGAGGAAGGAAAA
GGCTGATCAGCAACGTCAACGGAGCTCCGGTTTGTTCCTCTTTGGAGGGGCCAGTAGATAACAGTAATGTACAAATGGTG
GGACTTGAAGATAGGAGCCTTACCGGGTGGGGAAACGCAACCAGAAGACCAAGGAGACAAAGATGCCCTGCAGGTAGTAC
TCCACCAACTGTGATCTTAACATAA