Details for Chinese cabbage Locus Brara.G02863

Position : A07 ( 5`- 22994883 .. 22996097 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G02863

Protein [Map View]
MLTNRNRPINTISYLVVFFLLSTATAARNESNRTHGANRRFQHAYYSYPHRSCQSFSRPYARSMCIELERIHRSSRQPLF
SPPPPSPPEIDERYGVDKRLVPSGPNPLHN*

DNA
ATGCTGACTAACCGGAACCGTCCGATCAACACCATCAGTTACCTCGTCGTGTTCTTCCTTCTTTCAACCGCAACAGCAGC
AAGAAACGAGTCTAACCGAACCCACGGAGCAAACCGGAGGTTTCAACACGCGTACTACTCTTATCCTCACCGCTCATGCC
AATCTTTCTCTCGTCCCTACGCACGCTCTATGTGCATTGAGCTCGAAAGAATCCACAGAAGCAGCCGACAGCCACTTTTC
TCTCCTCCTCCTCCTTCTCCGCCGGAGATTGACGAAAGGTACGGCGTCGACAAAAGACTCGTCCCCTCCGGTCCAAACCC
GCTTCATAACTGA