Details for Chinese cabbage Locus Brara.G02861

Position : A07 ( 5`- 22982221 .. 22984186 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G02861

Protein [Map View]
MSVLLPLCLVLSMITYSNAAYCVCKDGNEQVLQKAIDYACGAGADCYQIQQNGACFQPNTVKNHCDVAVNSYYQKKASSG
ATCDFNGAAVISTSPPSTASSCLTGSSSSGTPSTGTPTTGTPSTGTPTTGTPSTGTPTTGTPTSGFPSTGTPSTGTPTAG
MPTTGTPSTGMPNSGTPANGMPTSSSSSVFPGTTLGPTGSGGFGDPNAGEKISVRTNTAFFLLTGVAIMLVV*

DNA
ATGTCGGTTTTACTTCCTCTGTGTCTGGTTCTCTCCATGATTACCTATTCAAATGCTGCGTATTGTGTATGCAAAGACGG
GAACGAGCAAGTGCTTCAGAAAGCTATAGATTATGCATGTGGAGCAGGAGCTGACTGCTATCAGATCCAGCAGAACGGAG
CTTGTTTCCAGCCTAACACCGTCAAAAACCACTGCGACGTCGCCGTCAACAGTTACTACCAGAAGAAAGCTTCCTCCGGT
GCCACCTGTGACTTTAACGGCGCCGCCGTTATCTCTACCTCCCCTCCGTCAACTGCTTCAAGCTGTTTAACTGGTTCCAG
CTCTAGTGGGACCCCGTCCACTGGGACTCCCACCACAGGAACCCCAAGCACTGGAACACCAACCACAGGAACCCCAAGCA
CTGGGACACCAACCACGGGGACTCCAACCAGTGGCTTCCCATCCACCGGGACTCCGTCGACCGGGACACCTACTGCCGGA
ATGCCAACCACGGGGACTCCTTCCACTGGCATGCCAAATTCCGGCACGCCAGCAAACGGAATGCCAACTTCGTCTTCATC
ATCCGTGTTCCCTGGCACTACTCTTGGACCGACCGGGAGCGGGGGATTCGGCGATCCGAACGCTGGAGAGAAGATCTCAG
TCCGAACTAACACTGCCTTCTTCTTACTAACCGGTGTAGCTATTATGCTTGTGGTTTAA