Details for Chinese cabbage Locus Brara.G01706

Position : A07 ( 5`- 16485025 .. 16485671 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01706

Protein [Map View]
MLYMKLKTQTHLDSLNNMESSSSSTFLTTTSLDQRNLSPVSRKPLKQKKKTSSTDKHIKVRYISNPMRVKTCASKFRELV
QELTGQNAVDLQPEPMFSPSVSDHSPSPPPPENLDSRVLQQEPFDDQLTDYYEPLDGEDMFLPHMSAGFSGLFSNGFYNV
NDLRRIDSV*

DNA
ATGTTATATATGAAGCTAAAGACACAAACTCATCTGGATTCTCTCAACAACATGGAGTCATCATCCTCATCAACGTTTCT
CACCACCACAAGCTTAGATCAGAGAAACCTATCTCCGGTTTCAAGAAAACCACTAAAGCAAAAGAAGAAGACGAGTTCAA
CCGACAAACACATCAAAGTGCGTTACATATCAAATCCCATGAGAGTCAAAACTTGTGCTTCCAAGTTCAGAGAGCTCGTA
CAAGAACTCACCGGCCAAAACGCCGTCGATCTTCAACCGGAGCCCATGTTTTCCCCCTCTGTCTCCGACCACAGCCCTTC
TCCGCCACCGCCGGAGAATCTTGATTCACGTGTTCTTCAGCAGGAGCCGTTCGATGATCAGTTGACTGACTACTATGAGC
CGTTGGATGGGGAAGATATGTTTTTGCCTCATATGTCGGCAGGTTTCTCCGGGTTGTTCTCTAATGGCTTTTACAATGTT
AATGACCTTAGAAGAATCGATTCTGTGTAA