Details for Chinese cabbage Locus Brara.G01704

Position : A07 ( 5`- 16453293 .. 16455144 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01704

Protein [Map View]
MKSKLIPIIGDIGEDNLGIGSEIAANISGEIDVVISCAGRTTFDDRYDLALNVNAFGPGRLLSFAKDCKKLKLFLHISTA
YVTGKKEGTVLETPLCIGKNITSDLNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENTYTFTKAMGETLIQT
MREDVPIVIIRPSIIESSYKEPFPGWLQGIRMTDPMILAYGKGQISGFWGDSQSFLDIIPVDMVVNATIAAMAKHGCGNS
DLKVYNVTSSSHAHPLRAGEYMDLCYQHLCDFPLTVIDLTRWKFHSSLDGFTSSVFDIIAKQERGTKNEGGEAEESHTTL
SFKGKRILDYFVSLARTYEPYTFFQARFDDTNTRSLIQEMSIEEIEMFEFDIKSIDWKHYIVNVHLPGLKRESLKERSN*

DNA
ATGAAAAGCAAGTTGATTCCAATAATTGGAGACATAGGAGAAGACAATCTGGGGATCGGATCTGAAATAGCAGCCAATAT
TAGTGGCGAGATTGATGTCGTTATCAGCTGTGCAGGTCGCACGACATTTGATGACAGATACGACCTTGCTTTAAATGTCA
ACGCTTTTGGACCTGGTCGGCTCTTGAGCTTTGCCAAAGACTGCAAGAAACTGAAACTGTTTCTCCATATCTCAACTGCT
TATGTGACTGGTAAGAAAGAGGGAACAGTACTAGAGACTCCTCTCTGCATTGGAAAAAACATAACTTCTGACTTGAACAT
CGAACATGAGCTGAAATTAGCTTCAGAAGCTGTAAGAAAGTTGCATGGCAGTGGAGAAATCAAGAAGCTGAAAGAACTTG
GCATCCAAAGAGCTCAACACTACGGCTGGGAAAACACGTACACGTTCACAAAAGCAATGGGTGAGACTTTAATCCAAACC
ATGCGAGAAGATGTGCCTATAGTGATCATAAGGCCTAGTATTATAGAAAGCTCTTACAAGGAGCCTTTCCCTGGCTGGCT
CCAAGGAATAAGGATGACTGATCCAATGATCTTGGCCTATGGTAAAGGCCAAATTTCTGGCTTCTGGGGAGATTCTCAAT
CTTTTTTGGACATTATACCTGTTGATATGGTTGTGAACGCAACAATAGCAGCAATGGCAAAGCATGGTTGTGGAAACTCC
GATCTCAAAGTTTACAATGTCACTTCTTCATCTCATGCGCACCCCCTACGAGCTGGCGAGTATATGGACCTCTGTTATCA
ACATTTGTGTGACTTTCCATTGACAGTAATAGACTTAACGCGATGGAAATTCCACAGTTCCTTAGATGGTTTCACCTCCT
CTGTATTCGACATAATAGCAAAACAGGAAAGAGGAACTAAGAATGAAGGTGGAGAAGCAGAAGAGTCACATACCACATTG
AGCTTCAAGGGAAAAAGGATACTAGACTATTTTGTGTCCCTAGCAAGAACATATGAGCCTTACACGTTCTTTCAAGCTCG
GTTTGATGACACCAATACAAGGAGTCTTATTCAGGAGATGTCAATTGAAGAGATAGAGATGTTTGAGTTTGATATCAAAA
GCATTGACTGGAAGCATTACATTGTGAACGTTCATCTTCCAGGTCTCAAAAGGGAATCTTTGAAGGAAAGATCAAATTAA