Details for Chinese cabbage Locus Brara.G01702

Position : A07 ( 5`- 16445734 .. 16447522 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01702

Protein [Map View]
MEFLIIIILFLVSLPIFIFFIFPRQPPSHIGFKSYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGNQQFVMT
ANPANVEFMLKTKFDSFPKGERFISFLEDFLGRGIFNSDGEMWWKQRKTASYEFSTRSLRDFVMTNVTVEINTRLVPVLA
AAATAGESIDLQDILERFAFDNICKLAFNVDAACLGDDGADGVEFMRAFETAATIISKRFQSVVSYSWKIKKKLDIGSEK
VLRESIVTVHKFADDIVRHTIDDQARSSNTNEDLLSRFINIEEMSSPELLRDIVISFILAGRDTTSSALSWFFWLLSKHP
EVEDKIRQELNSIRARTGKRVGEVYGFEELKLMNYLHAAITESLRLYPPVPVDTMSCVEDNVLPDGTFVGKAWGISYNAY
AMGRMESIWGKGCDRFDPERWIDETNGGFRGENPYKFPVFHAGPRMCLGKEMAYIQMKSIVAAVLDRFVVEVPGKKERPE
ILLSMTLRMKGGLFARIHERT*

DNA
ATGGAGTTTCTCATCATCATCATCCTCTTCCTTGTCTCTCTCCCTATCTTCATCTTCTTCATCTTCCCAAGGCAACCGCC
CTCACACATCGGTTTCAAATCCTACCCGATCGTCGGCAGCATACCTGGACTGGTGAAAAACCGTCACCGTTTCCTCGATT
GGACGGTAGAGACTCTGTCCAGATGTCCGACACAAACAGCTGTTTTCCGGCGACCAGGGAACCAACAGTTCGTCATGACG
GCGAATCCAGCAAACGTCGAGTTCATGCTCAAGACGAAGTTCGATAGCTTCCCTAAAGGCGAGCGGTTCATCTCGTTTCT
TGAGGATTTTCTTGGCCGTGGGATATTCAACTCCGACGGCGAGATGTGGTGGAAACAGAGGAAGACGGCGAGCTACGAGT
TCAGTACTAGGTCGCTCCGTGACTTCGTTATGACCAACGTCACCGTCGAAATCAACACCAGGCTTGTTCCCGTGTTAGCC
GCGGCGGCGACCGCCGGAGAATCGATAGACCTTCAAGATATATTGGAACGCTTCGCGTTCGATAACATATGCAAGTTAGC
ATTCAACGTCGATGCCGCTTGCCTCGGCGACGACGGAGCAGACGGTGTAGAGTTCATGAGAGCCTTCGAAACGGCGGCGA
CGATCATCTCGAAACGGTTTCAGTCCGTGGTCTCGTATTCATGGAAGATCAAGAAGAAACTTGACATAGGATCAGAGAAG
GTTCTGAGAGAATCAATCGTGACCGTCCATAAATTCGCAGACGATATCGTGCGTCACACGATTGATGATCAAGCTAGGTC
AAGTAACACGAACGAGGATTTGCTTTCAAGATTCATCAACATCGAGGAGATGAGTTCGCCGGAGCTGCTTCGTGATATTG
TCATTAGTTTCATCCTCGCGGGACGAGACACGACATCCTCTGCTTTGAGCTGGTTCTTCTGGTTGCTCTCTAAGCATCCA
GAAGTTGAAGACAAGATCAGACAAGAGCTGAACTCGATCAGGGCAAGAACAGGGAAACGTGTCGGAGAAGTTTACGGGTT
TGAGGAGCTTAAACTGATGAACTATCTACACGCAGCTATAACTGAGTCTCTTAGGTTATATCCTCCTGTGCCAGTGGACA
CAATGAGTTGCGTTGAGGACAATGTATTGCCTGATGGGACATTTGTAGGGAAAGCTTGGGGAATAAGTTACAACGCGTAC
GCGATGGGGAGGATGGAGAGTATTTGGGGGAAGGGTTGTGATAGGTTTGATCCAGAGAGGTGGATTGATGAAACAAATGG
TGGGTTTAGAGGTGAGAATCCTTACAAGTTTCCGGTGTTTCATGCAGGACCAAGGATGTGTTTAGGTAAGGAGATGGCTT
ATATTCAGATGAAGTCGATAGTTGCTGCGGTGTTGGACAGGTTTGTTGTTGAGGTTCCGGGGAAGAAGGAGCGTCCTGAG
ATTCTCTTGTCTATGACACTTAGAATGAAAGGTGGTTTGTTTGCTAGGATACATGAAAGAACCTGA