Details for Chinese cabbage Locus Brara.G01698

Position : A07 ( 5`- 16428543 .. 16431952 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01698

Protein [Map View]
MTKVCPETGERTLQEPVLTVSTDVSFASNHFPTYKLGPDNEIVDEPKEDQKGPSMKETVEEESQLLSDQHKRLSVRDLAS
KFDKKLAAAVSLADEAKLKEVASLEGHVMLKKLRDALEYMRGRTDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEV
KKLGNFLKQTSEDAKKLVNHEKSFACAEIESARAVVLRLGEAFEEQERSSEASRAQGPDVEKMVEEVQEARQIKRMHHPT
KVMGMQHELHGLRSRIQEKYMNSVRLHQEIATIKRAEESKSCPFVLEGTQSLGSCLQIRVNAPDNAIELSNCSIQWYRAA
CETSRREAISGANQSVYAPEPFDVGRILQADILSNGHKVTVTTDGPIDPDAGLQSRIDSLMKKSNSEFSVVISQMNGQDY
ASRSHVFTVGKTRIKLSRGWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFTLTFESEQERNTAIALARKYAF
DCNVTLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAAACGGGAGAAAGAACATTACAAGAACCAGTTCTTACAGTATCAACGGATGTGAGCTTTGC
TTCTAACCATTTCCCAACGTACAAGTTAGGACCTGATAATGAGATAGTAGATGAACCTAAGGAAGATCAGAAAGGTCCAT
CAATGAAAGAAACCGTCGAGGAAGAGAGTCAGCTCTTGTCTGATCAGCACAAGCGTCTTTCAGTGCGTGATCTCGCGAGT
AAATTTGACAAGAAGTTGGCTGCAGCTGTTAGTTTGGCTGATGAGGCAAAGCTAAAAGAGGTAGCTTCTTTAGAGGGACA
TGTTATGTTGAAGAAGCTAAGAGATGCTTTAGAATACATGAGAGGACGCACGGATGGGCAGAACAAGGAAGATGTGGAGA
AAGCTATCTCCATGGTTGAAGCTCTAGCTGTGAAGTTAACTCAGAATGAAGGTGAACTAATTCAAGAAAAGTTTGAAGTG
AAGAAACTTGGAAACTTCCTCAAGCAGACTTCAGAAGATGCAAAGAAACTAGTAAACCATGAAAAGTCATTTGCATGCGC
TGAGATCGAAAGTGCGAGAGCCGTTGTGCTTAGACTTGGAGAGGCATTTGAAGAACAGGAGCGAAGCTCTGAAGCCTCTA
GAGCTCAGGGACCGGATGTTGAGAAAATGGTTGAGGAGGTTCAGGAAGCTAGACAGATCAAACGCATGCATCACCCAACA
AAGGTGATGGGCATGCAACATGAGCTTCATGGTTTAAGAAGCCGAATCCAAGAGAAGTATATGAACTCTGTTAGACTTCA
TCAAGAGATAGCAACAATCAAAAGAGCTGAGGAATCCAAGTCATGTCCATTTGTTCTAGAAGGCACACAAAGTCTCGGCT
CTTGCTTACAAATCCGTGTCAATGCTCCAGATAATGCTATAGAACTTTCCAACTGTTCGATCCAGTGGTACCGTGCAGCA
TGTGAAACTAGCCGAAGGGAAGCTATATCTGGTGCCAACCAATCAGTGTATGCTCCAGAACCATTTGATGTTGGGAGGAT
CTTACAGGCAGACATTCTTTCAAATGGACACAAAGTCACAGTTACAACCGATGGTCCAATTGATCCTGATGCTGGCTTGC
AATCCCGAATAGATTCTTTGATGAAAAAATCCAACAGTGAATTCAGCGTGGTTATATCACAGATGAATGGACAAGACTAT
GCATCCCGATCTCATGTCTTTACCGTTGGTAAGACGAGGATAAAGCTGTCTCGAGGATGGATCACAAAGGCGAGAGAAAT
ATATTCAACATCCATGCAGCTCTGTGGAGTTAGAGGCAATATTAAGGCTCCGGCCAAAGCGTTGTTCTGGCAACCAAGAA
AGAGTCTAACTTTCACACTAACCTTTGAGTCAGAACAAGAACGTAACACAGCCATAGCCCTTGCTCGAAAATACGCTTTT
GATTGCAATGTTACATTGCTTGGGCCAGATGATTAA