Details for Chinese cabbage Locus Brara.G01697

Position : A07 ( 5`- 16426256 .. 16428149 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01697

Protein [Map View]
MEALVCRKLGDPTATEPGSPESPVEVSKNHPIPPLTSDTAVRVKVTATSLNFANYLQILGKYQEKPPLPFIPGSDYSGVV
DAIGPAVTKFRVGDRVCSFAALGSYAQFIVADQSLLFLVPEGCDMIAAAALPVAFGTSHVALVHRARLTSGQVLMVLGAA
GGVGLAAVQIGKICGAIVIAVARGSEKIQLLKSMGVDHVVDLGSENVITSVKEFVKTRKLKGVDVLYDPVGGKLTKDSMK
VLNWGAQILVIGFASGEVPLIPANIALVKNWTVHGLYWGSYKIHQPNVLDDSIRELLSWLARGVITMHISHTYSLSQANL
AFGAIKDRKVIGKVMIALDHKATLSSKL*

DNA
ATGGAGGCTTTGGTTTGCCGGAAACTAGGAGATCCGACGGCGACGGAGCCAGGGAGTCCAGAATCTCCGGTGGAAGTGAG
CAAAAACCACCCGATCCCGCCTCTAACCTCCGATACAGCGGTGAGAGTCAAAGTCACAGCAACGAGCTTGAACTTTGCGA
ATTACCTTCAGATTCTCGGAAAGTACCAGGAGAAACCTCCGTTGCCTTTCATCCCTGGCTCCGACTACTCCGGAGTCGTC
GACGCCATCGGTCCCGCCGTCACCAAATTCCGCGTCGGTGATCGCGTGTGCTCCTTCGCCGCTCTCGGTTCCTACGCTCA
GTTCATCGTCGCCGACCAGTCTCTCCTGTTCCTTGTACCGGAAGGATGCGACATGATCGCTGCAGCTGCACTTCCTGTTG
CGTTTGGGACTTCTCATGTTGCTCTTGTCCATAGAGCTCGTTTAACTTCTGGTCAGGTCTTGATGGTTCTTGGCGCTGCT
GGTGGCGTTGGTCTTGCAGCTGTTCAAATCGGGAAGATTTGTGGAGCCATTGTCATTGCAGTTGCTAGAGGGAGTGAGAA
GATTCAGCTGTTGAAGTCAATGGGAGTGGATCATGTTGTTGATTTAGGCAGTGAGAATGTTATTACAAGCGTCAAAGAGT
TCGTCAAGACAAGAAAGCTTAAAGGAGTTGATGTTCTGTATGATCCTGTCGGAGGGAAACTCACCAAGGACTCCATGAAA
GTTCTCAACTGGGGAGCTCAGATTCTTGTGATTGGTTTCGCAAGCGGTGAAGTACCTCTCATTCCCGCTAACATAGCCCT
TGTTAAGAACTGGACGGTGCATGGTCTTTATTGGGGCAGCTACAAAATCCACCAACCCAATGTTCTTGATGATTCCATCA
GAGAGTTACTGTCATGGCTTGCCAGAGGAGTGATCACCATGCACATCTCTCATACCTATAGCCTCTCCCAGGCCAATCTT
GCATTTGGGGCCATCAAAGACAGGAAAGTAATAGGAAAAGTGATGATTGCTCTCGACCACAAGGCTACTCTGTCTTCAAA
ACTATAG