Details for Chinese cabbage Locus Brara.G01695

Position : A07 ( 5`- 16419309 .. 16424321 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01695

Protein [Map View]
MMKKKKHSRSQSSSKKTIEPSPDSSPSPSPRLLSIFRSKLVSGKDLKHMFRGMKTKTAPGLSSQSRIVRCPKCHKLLQEP
IDATIYKCSGCNSILQAKRWDLESNGDSIPEALLYSQNRSLSTQLESAEAGSKTPMRSTHREYKHETSDVHREWMRRADE
FSVTGDSDAFASARSSPYNSRSNASEWTQHERRYQVPFYPASPSPSSAYEYGYNSPFHGSQASASEKSYYHHHQPNQFKQ
KEREGWFQESSASASPIRFPGETSNKNYYPSSSQYHNLYEPRSSVYSERSYQAPLRSTYSEHSKSGTSREKRSQRDKKKD
VRKKKPVVKRYVLPSAGGAPFATCSYCLELLQLPQVSLHGKHKGYQVRCGSCSGVLNFSVREKADTGFAEETVSNHQDSA
SEGHDVESFEDNESKEDTRSMSSTLLDSKLEALQPSLNQKVREQQPESSESIGETSRKHLEQYEEACSEKSTEMDDNISE
RVSCDVEEVGLYEKNETLEPEVMFGDGSGESLEVPVYKKERMSDSSIEAETVADTHVPHIGEPNEHVCETRILSENTGVT
QGFDWEESQENEECGGEGKWEDITGDKPGLVLEKSQCIADSICDSSSSNGEIYEDTAVKEDTNHILASPQNENKRFIGLP
DQSGEATVVTSRTHGEKFKYEHENLSERQELVKTISDRVKYELQETRYETSEALDTDKVSEDGSAVSLTKASDTFSTSIE
GERDEERSVSHQMDLPNENVEDSYERLEYACERTWAETMEARAGLHLEEYESNYENYSRPFELTSEGSSALHMHEYEQGM
INEPEEDADGRLESSSKGSFSDHEIAEESPEFQESQDAKSDYEMPTERQELSNTVFDTVTPSEPNIGVTGEERSVYHHMA
SEDENLEFSYGTVEQVYLEGSGYASERTWAEAKDDGAGLQLEECHNNPHEWTSERAPTFRLHESELGTMSASEEDAYGRS
SSSTDSTNDHEAVAHEKPSLMDENKLEELRVSLMVEDGPSLHLEKYGNDSTKLEDTVEWTSERAPTFRLHDSELGTMLEP
EEHPDRGSESSSTGSFNNHVSSKLRTDFHEEEEEELQLHEMTEDRVALDLKKGENGSIKLEETFEWTSERAPTFRLHDSE
LVTRLEPDEDADGRSESSSRGTFNDHVISKEREMYHEEPRLVIHSRTKVEQVDQVEKDTVLNETFKWTSERVLTFTHREY
ELGTMLEPDEDASESSLRGSFNDHGVSKERAVSHKDEPWLVDDYETKALKASVMADNEPPLHLEKCENEKVVLNQTLEPR
DDLFKLSHDDTLEQERIAFHLEKSQDKQVNLRQTFKQQGDTEHNIPASEGHESPCKMAEVDSEAEEDMLGHHLEPLQIEN
ERSGLTSEPYSHFCNTTDPSEIVGLRLALYETQTSPLSSPMHTPTGSPLHILMRSPIASPMRTHIVSPMRSPINSSGSLS
DVLFFGKKA*

DNA
ATGATGAAGAAGAAGAAACACAGCAGATCCCAATCTTCTTCCAAGAAAACTATTGAACCATCCCCAGATTCTTCACCTTC
ACCTTCACCTAGGCTCCTCTCCATTTTTCGTTCTAAGTTGGTAAGTGGTAAAGACTTGAAGCATATGTTCAGAGGCATGA
AGACCAAAACTGCACCTGGACTGTCTTCTCAGTCTAGAATCGTGAGATGTCCCAAGTGCCACAAGCTTCTCCAAGAACCT
ATAGATGCCACTATTTACAAATGCAGTGGATGCAACTCCATTCTCCAAGCAAAACGTTGGGACCTGGAAAGCAATGGCGA
CTCTATTCCAGAGGCCCTCCTTTATTCTCAAAACCGTAGTTTAAGTACACAGTTAGAATCTGCAGAAGCTGGTAGTAAAA
CTCCAATGAGGAGCACTCACCGGGAGTACAAGCATGAGACATCTGATGTCCATAGAGAATGGATGAGAAGGGCTGATGAG
TTCAGCGTGACCGGTGACTCTGATGCTTTTGCTTCAGCAAGAAGCTCTCCTTATAACTCACGCAGCAATGCCTCGGAGTG
GACACAGCATGAGAGGAGATATCAGGTTCCTTTCTATCCAGCTAGTCCTTCTCCTTCTTCTGCGTATGAGTATGGCTACA
ATAGTCCCTTTCACGGGTCTCAAGCTTCTGCATCCGAGAAGTCTTATTATCATCATCATCAACCAAACCAATTCAAGCAA
AAGGAGAGAGAAGGCTGGTTTCAAGAATCTTCTGCTAGTGCTTCACCAATTCGTTTCCCTGGTGAGACATCTAATAAAAA
CTACTATCCCTCGTCTTCTCAGTATCATAATCTCTACGAACCCAGGAGCTCTGTGTACTCTGAGCGTAGTTATCAAGCGC
CACTTCGTTCCACATACTCTGAGCATTCCAAGAGTGGGACAAGTCGTGAGAAGAGATCTCAAAGGGACAAAAAGAAGGAT
GTTAGAAAGAAGAAGCCGGTGGTGAAACGCTATGTGCTTCCTTCAGCGGGTGGAGCGCCGTTTGCAACTTGTTCCTACTG
CTTAGAACTTCTCCAGCTTCCTCAGGTGTCTCTCCATGGAAAACATAAGGGGTATCAAGTGAGATGTGGCAGTTGTTCCG
GTGTACTTAACTTCTCTGTTCGAGAGAAAGCAGATACTGGTTTTGCTGAGGAGACTGTTAGTAATCATCAGGATTCAGCT
TCAGAAGGTCATGATGTGGAAAGTTTTGAGGATAATGAGAGTAAAGAAGACACAAGGAGCATGTCAAGCACATTATTAGA
TTCGAAACTGGAGGCGTTGCAGCCTTCACTGAACCAGAAGGTGAGGGAACAACAACCTGAATCAAGTGAGAGTATCGGAG
AAACTTCAAGAAAGCATCTAGAGCAATATGAGGAAGCTTGTTCAGAGAAGTCAACCGAGATGGATGACAACATTTCTGAG
AGAGTCAGTTGTGATGTAGAGGAGGTTGGATTATATGAGAAGAATGAAACTCTTGAGCCAGAAGTGATGTTTGGAGATGG
ATCAGGTGAGTCCTTAGAGGTTCCAGTATACAAGAAGGAAAGAATGAGTGATTCAAGTATAGAAGCTGAGACAGTTGCAG
ATACACATGTACCTCATATTGGTGAACCGAACGAACACGTCTGTGAAACACGTATACTGTCTGAGAATACCGGAGTCACT
CAAGGGTTTGATTGGGAGGAGAGTCAAGAAAATGAAGAATGTGGAGGTGAAGGTAAATGGGAAGATATCACGGGAGACAA
ACCGGGGTTGGTTTTGGAGAAATCTCAGTGCATTGCAGATTCAATCTGTGACAGCAGCTCAAGCAATGGTGAAATATATG
AGGATACAGCGGTCAAGGAAGATACAAATCACATATTAGCTTCACCACAGAACGAGAACAAGAGGTTTATAGGACTTCCT
GACCAATCAGGTGAGGCTACAGTAGTAACATCCAGGACTCATGGGGAGAAGTTCAAGTATGAGCATGAGAACTTAAGCGA
AAGACAAGAGTTGGTAAAGACCATTAGTGACAGAGTCAAGTATGAGTTACAGGAGACTAGATACGAGACAAGTGAGGCTC
TTGATACCGACAAGGTGAGCGAAGATGGATCTGCTGTTTCTCTCACGAAGGCGAGTGATACGTTCAGCACAAGCATAGAA
GGCGAGAGAGATGAAGAGAGATCGGTATCTCATCAAATGGATCTTCCAAACGAGAATGTAGAAGATTCCTATGAAAGACT
AGAGTATGCATGTGAAAGAACATGGGCAGAAACTATGGAAGCTAGAGCTGGTTTGCATTTGGAGGAATATGAAAGCAACT
ATGAGAACTACAGCAGACCATTTGAATTGACTTCAGAAGGATCTTCGGCATTGCATATGCATGAGTATGAGCAAGGGATG
ATAAATGAACCAGAAGAGGATGCTGATGGAAGATTGGAATCCAGTTCAAAGGGTTCCTTCAGTGACCATGAAATTGCAGA
AGAGAGTCCTGAATTTCAGGAATCTCAAGATGCTAAATCAGATTATGAGATGCCAACCGAAAGACAAGAGTTGAGTAACA
CCGTTTTTGACACGGTAACACCGTCTGAGCCAAACATAGGCGTGACAGGTGAAGAGAGGTCGGTATATCATCATATGGCT
TCTGAAGACGAGAATCTGGAGTTTTCATACGGAACAGTAGAACAAGTTTATCTGGAAGGAAGCGGATATGCAAGTGAAAG
AACATGGGCAGAGGCAAAGGACGATGGAGCCGGGTTGCAGTTGGAGGAATGTCATAACAATCCACATGAATGGACTTCAG
AAAGAGCTCCAACATTTCGTCTGCATGAGTCTGAGCTAGGGACAATGTCTGCATCGGAAGAAGATGCGTATGGAAGATCA
TCCAGTTCAACAGATTCCACCAATGACCATGAAGCTGTGGCTCATGAGAAGCCTTCGCTGATGGATGAGAACAAATTGGA
AGAGCTAAGAGTTTCTCTAATGGTGGAAGATGGGCCATCATTGCACTTGGAGAAGTACGGAAATGATTCAACGAAACTGG
AAGATACAGTTGAATGGACTTCAGAAAGAGCTCCGACATTTCGTCTGCATGACTCTGAGCTAGGGACAATGCTTGAACCA
GAAGAGCATCCTGATAGAGGATCGGAATCCAGTTCAACTGGTTCCTTTAATAACCACGTAAGTTCAAAGTTGAGAACTGA
CTTCCACGAGGAGGAGGAGGAGGAGCTACAACTACACGAAATGACAGAAGATAGGGTGGCATTGGACTTGAAGAAGGGTG
AAAACGGATCAATAAAATTGGAAGAGACATTTGAATGGACTTCAGAAAGAGCTCCAACGTTTCGTCTGCATGACTCTGAG
CTAGTGACAAGGCTTGAACCAGACGAGGATGCTGATGGACGATCAGAATCTAGTTCAAGGGGTACCTTCAACGACCATGT
AATTTCAAAAGAAAGAGAGATGTATCATGAGGAGCCCAGGCTGGTGATTCATAGCAGAACCAAAGTGGAACAAGTAGACC
AAGTGGAAAAAGATACAGTACTGAATGAGACATTTAAGTGGACTTCAGAGAGAGTTTTAACATTTACTCACCGTGAGTAT
GAGCTAGGGACAATGCTTGAACCGGACGAAGATGCATCAGAATCTAGCTTAAGGGGTTCCTTCAATGACCATGGAGTTTC
AAAAGAAAGAGCTGTCAGTCACAAGGATGAGCCTTGGCTGGTGGATGATTATGAAACCAAAGCGCTTAAAGCAAGCGTAA
TGGCAGATAACGAACCACCACTGCACTTGGAGAAGTGTGAAAATGAAAAAGTGGTACTGAACCAGACACTTGAACCAAGG
GATGATTTATTCAAGCTCAGTCATGATGACACACTTGAGCAAGAGAGGATAGCGTTTCATTTGGAGAAGTCTCAAGACAA
GCAAGTGAATCTAAGGCAGACCTTTAAACAACAAGGCGACACTGAACACAACATACCAGCATCTGAAGGCCATGAGTCCC
CATGCAAAATGGCCGAAGTAGACAGTGAAGCTGAAGAGGATATGTTGGGACACCATTTAGAGCCATTGCAGATAGAGAAT
GAGAGGTCAGGACTAACCTCTGAACCGTATTCTCATTTCTGTAACACAACGGATCCCTCTGAGATTGTGGGTCTGCGTCT
TGCGTTATATGAAACCCAAACTTCACCTCTCAGTTCACCAATGCACACACCCACTGGTTCCCCACTGCACATCCTGATGC
GTTCTCCGATTGCTTCACCAATGCGTACCCACATAGTTTCACCAATGCGTTCTCCCATCAACTCATCAGGATCACTCTCT
GATGTATTGTTCTTCGGCAAGAAAGCTTGA