Details for Chinese cabbage Locus Brara.G01690

Position : A07 ( 5`- 16393106 .. 16394077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01690

Protein [Map View]
MGLRALPLQHNSGFISTTKVPISRTSQRLSRNPRWVVVSAKQEKDEEKKREDETSLFTRLTDALDFAQVRSEKDAELLYE
AREATKSGGKMSKEQYGALRRKIGGTYKDFFKSYVEVDGEYVEEGWVDKTCKICKKDTKGEARQVDKAGRYAHVSCLQNP
SNSSGNFFTRLFSR*

DNA
ATGGGTCTAAGAGCACTGCCTCTTCAACATAATAGTGGATTCATCTCCACGACCAAAGTCCCGATCTCAAGAACCTCGCA
GAGATTAAGCCGGAACCCTAGATGGGTCGTGGTGTCGGCCAAGCAAGAGAAAGATGAGGAGAAGAAGAGGGAAGATGAGA
CTTCATTGTTCACCAGACTAACAGATGCGTTGGATTTCGCACAGGTTCGGTCGGAGAAAGACGCCGAGCTTCTCTATGAG
GCCCGTGAAGCCACCAAATCTGGTGGCAAGATGAGCAAAGAACAGTATGGGGCGTTGAGAAGAAAAATCGGAGGGACATA
CAAGGACTTCTTTAAATCCTACGTTGAAGTGGATGGAGAATATGTGGAGGAAGGATGGGTGGACAAAACATGTAAGATAT
GCAAAAAGGACACAAAGGGTGAGGCAAGACAAGTGGACAAGGCAGGGAGATATGCTCATGTCTCCTGTCTTCAAAACCCC
TCCAACTCTTCTGGAAATTTCTTCACCAGACTCTTCTCAAGATGA