Details for Chinese cabbage Locus Brara.G01688

Position : A07 ( 5`- 16386625 .. 16388226 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01688

Protein [Map View]
MEPHRPLAGRPQRKPLGDCTNTISRTPQLPSSPSSVKFANPSLSSSLKRLVDQTSLKEKAQDVNNSSKVVPGGGTVSKSV
RPVTRCTSADLGSPAATTSSPPSKPDDVGKPDAGAASRLRPVTRRMSADLGFPASAPPRPRSGVGDKDFTEPYSVYTVRR
KASGRKRNKDVSSSSAMPRLRLDLLSSPGKRKLQADENKTKPSKVAPKKRQRTVKKHKEDNVDQEYIEQQKAYFAEVDAF
ELQEEEVSSSDLD*

DNA
ATGGAACCTCACCGTCCCCTCGCAGGAAGACCACAGAGAAAACCCCTCGGAGATTGCACCAACACCATCTCCAGAACTCC
CCAACTTCCATCTTCTCCTTCCTCCGTCAAATTCGCGAACCCGAGCCTCTCGTCTTCTCTCAAGCGATTAGTAGACCAAA
CCTCCCTCAAGGAGAAAGCCCAAGATGTCAATAACTCCTCAAAGGTTGTTCCCGGAGGCGGAACCGTTTCCAAGTCCGTT
AGGCCCGTGACTCGCTGTACGTCCGCCGATCTGGGATCTCCGGCGGCCACTACGTCTTCTCCTCCCTCGAAACCGGATGA
TGTCGGTAAACCAGACGCTGGTGCCGCGTCACGGTTAAGACCCGTAACTCGCCGTATGTCCGCGGATCTAGGTTTCCCGG
CCTCCGCGCCGCCTCGGCCTCGCTCCGGTGTTGGTGACAAGGATTTTACTGAGCCGTACTCGGTTTACACTGTTAGAAGG
AAGGCTTCTGGGAGAAAGAGGAATAAAGACGTGTCTTCCTCTAGTGCAATGCCTCGCCTTCGTCTTGACTTGTTATCAAG
CCCTGGGAAGAGGAAACTTCAAGCAGATGAGAATAAAACGAAGCCCTCAAAAGTGGCTCCCAAAAAGAGGCAGCGAACAG
TAAAGAAGCATAAAGAAGATAATGTGGATCAGGAATATATTGAGCAGCAGAAAGCCTACTTTGCAGAGGTCGATGCTTTT
GAGCTGCAAGAAGAAGAGGTATCTAGTAGCGACTTAGATTAA