Details for Chinese cabbage Locus Brara.G01683

Position : A07 ( 5`- 16347577 .. 16350002 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G01683

Protein [Map View]
MGDHLVRAEEFEKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHDAANAYAEAA
KCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYEADQKIDQAIAYYEKAAEFFQNEEVTTSANQCNLKVAQ
YASQLEQYEKAIKIYEDIARHSLGNNLLKYGVKGHLLNAGMCHLCKADVVSITNALEKYQDLDPTFTGTRECKFLSDLAG
AIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEKLKAKELEEDDLT*

DNA
ATGGGTGATCATCTGGTGAGAGCGGAGGAATTCGAGAAGAAGGCAGAGAAGAAGCTCAACGGATGGGGAATCTTCGGATC
TAAGTACGAAGACGCTGCCGATCTCCTCGAGAAAGCTGCTAATTCCTATAAACTCGCCAAATCATGGGATCAAGCTGGAA
AGGCTTATCTTAAACTTGCTGATTGTCACTTAAAGTCGGACAGCAAACATGATGCTGCTAATGCCTATGCTGAAGCTGCT
AAATGCTACAAGAAAGTTGACACTAATGAGGCTGCATCTTGTTTAGAGCGAGCAGTGAATATATTCTGCGAGATAGGGAG
GCTTAACATGGCTGCGAGATACTACAAGGAAATTGCTGAGTATTATGAAGCTGACCAGAAAATCGATCAGGCTATTGCTT
ACTATGAAAAGGCAGCTGAGTTTTTTCAGAATGAAGAAGTGACGACTTCTGCAAACCAGTGCAATCTAAAGGTGGCGCAA
TATGCTTCCCAGTTGGAGCAGTATGAGAAGGCAATCAAGATTTATGAAGATATAGCACGCCATTCCCTGGGGAATAACTT
GCTTAAGTATGGAGTTAAGGGCCATCTTCTCAATGCCGGCATGTGCCACCTTTGCAAAGCTGATGTTGTATCCATCACCA
ATGCTCTGGAGAAATATCAGGATCTGGATCCAACTTTTACAGGAACACGAGAATGCAAGTTCTTATCGGACCTTGCTGGT
GCCATCGATGAAGAAGACATCGCAAAGTTCACAGACGTTGTCAAGGAATTTGATAGCATGACTCCTCTGGATTCATGGAA
GACAACTATGTTGTTGAGGGTGAAGGAGAAGCTGAAGGCAAAGGAGCTTGAGGAGGATGATCTTACCTAA